DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT73C7

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_190884.1 Gene:UGT73C7 / 824482 AraportID:AT3G53160 Length:490 Species:Arabidopsis thaliana


Alignment Length:107 Identity:34/107 - (31%)
Similarity:54/107 - (50%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 FEDELLPGKPPNVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNM 389
            ||:.:   |...:.|..|.||..||:|.::..|:||.|..||:|.|..|.|:|..|...:||.|.
plant   336 FEERI---KDRGLVIKGWAPQVFILSHASIGGFLTHCGWNSTLEGITAGVPLLTWPLFAEQFLNE 397

  Fly   390 DHVRQV-GLGLVLNIKQM----TSEEFRSTIIRLLTNKSFEE 426
            ..|.|: ..||.:.::::    ..||..:.:.|....|:.:|
plant   398 KLVVQILKAGLKIGVEKLMKYGKEEEIGAMVSRECVRKAVDE 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 34/107 (32%)
UDPGT 30..511 CDD:278624 34/107 (32%)
UGT73C7NP_190884.1 Glycosyltransferase_GTB_type 7..489 CDD:299143 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.