DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT73D1

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_190883.2 Gene:UGT73D1 / 824481 AraportID:AT3G53150 Length:516 Species:Arabidopsis thaliana


Alignment Length:471 Identity:93/471 - (19%)
Similarity:161/471 - (34%) Gaps:155/471 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LAVFPLPSSSHYFFALPYLKSLASLGHEITSVSPYP-QREPFR-NIHDIPVPEVFENFNEVLRIA 83
            :..|.|.||.:.....|:| |::|      :|.|:| ...|.| .|....:|..||.        
plant   162 MCCFSLLSSHNIHLHSPHL-SVSS------AVEPFPIPGMPHRIEIARAQLPGAFEK-------- 211

  Fly    84 STPRSTWQSSDFINEYVLNLTKTVLNNEGVRRDILGPQKPHFDLVIMDLWRMDVLSGLA-AYFDA 147
                                   :.|.:.||..:...:...|.:::.....::  .|.| ||.:|
plant   212 -----------------------LANMDDVREKMRESESEAFGVIVNSFQELE--PGYAEAYAEA 251

  Fly   148 PIIGMASYGTDWKIDELMGNVSPISYLQSPSSRFYDLEAYGERLLHLMERTFSYMNYKWRHVRKQ 212
                         |::.:..|.|:|......:..:|..:.|                   ::...
plant   252 -------------INKKVWFVGPVSLCNDRMADLFDRGSNG-------------------NIAIS 284

  Fly   213 ETLYSQFFPSVAERKPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTE----ALS 273
            ||...||..|:..|..|              :.:||.....:||.:...||.::.|.:    .:.
plant   285 ETECLQFLDSMRPRSVL--------------YVSLGSLCRLIPNQLIELGLGLEESGKPFIWVIK 335

  Fly   274 AELDHFIQGAGESGVIYFSLGTNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPGKPPNVF 338
            .|..|.|:                    |.|..::   |.|            :|.:.|:  .:.
plant   336 TEEKHMIE--------------------LDEWLKR---ENF------------EERVRGR--GIV 363

  Fly   339 ISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRN---MDHVRQVGLGLV 400
            |..|.||..||:|.:...|:||.|..||||:|..|.||:..|...:||.|   :..|..:|:.:.
plant   364 IKGWSPQAMILSHGSTGGFLTHCGWNSTIEAICFGVPMITWPLFAEQFLNEKLIVEVLNIGVRVG 428

  Fly   401 LNIKQMTSEEFRSTI----------IRLLTNKSF------EETARITAARYRDQPMKPMETAIWW 449
            :.|.....:|.|..:          |:||.::..      ::.......|.|.|.:..|      
plant   429 VEIPVRWGDEERLGVLVKKPSVVKAIKLLMDQDCQRVDENDDDNEFVRRRRRIQELAVM------ 487

  Fly   450 TEYVLSHKGAAHMQVA 465
            .:..:..||::.:.|:
plant   488 AKKAVEEKGSSSINVS 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 92/466 (20%)
UDPGT 30..511 CDD:278624 89/462 (19%)
UGT73D1NP_190883.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.