DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT72E1

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_566938.1 Gene:UGT72E1 / 824238 AraportID:AT3G50740 Length:487 Species:Arabidopsis thaliana


Alignment Length:489 Identity:106/489 - (21%)
Similarity:168/489 - (34%) Gaps:174/489 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VLNLTKTVLNNEGVRRDILGPQKPHFDLVIMDLWRMDVLSGLAAYFDAPIIGMASYGTDWKIDEL 164
            |:.|.|.:..:.|            ||:.|..| ..|..|..:.:.::|       |.|..:.::
plant    22 VIELGKRLAGSHG------------FDVTIFVL-ETDAASAQSQFLNSP-------GCDAALVDI 66

  Fly   165 MGNVSP-ISYLQSPSSRFYDLEAYGERLLHLMERTFSYMNYKWRHVRKQET-------------- 214
            :|..:| ||.|..||:.|      |.:||.:|..|...:..|...::.:.|              
plant    67 VGLPTPDISGLVDPSAFF------GIKLLVMMRETIPTIRSKIEEMQHKPTALIVDLFGLDAIPL 125

  Fly   215 -------------------LYSQFFPS---------VAERKPL---------------------S 230
                               ..:.|||:         :.:::|:                     |
plant   126 GGEFNMLTYIFIASNARFLAVALFFPTLDKDMEEEHIIKKQPMVMPGCEPVRFEDTLETFLDPNS 190

  Fly   231 EISRNF----------DLVLVNQHFTLGPPRPYVPNMIQ-------VGGLHVDHSTEALSAELD- 277
            ::.|.|          |.::||   |.....|.....:|       :.|:.| :....||..:| 
plant   191 QLYREFVPFGSVFPTCDGIIVN---TWDDMEPKTLKSLQDPKLLGRIAGVPV-YPIGPLSRPVDP 251

  Fly   278 --------HFIQGAGESGVIYFSLGT--NVKSKSLSEDRRKVLLETFASLPQRIVW--------- 323
                    .::....:..|:|.|.|:  ::.:|.|:|     |........||.||         
plant   252 SKTNHPVLDWLNKQPDESVLYISFGSGGSLSAKQLTE-----LAWGLEMSQQRFVWVVRPPVDGS 311

  Fly   324 -----------KFEDELLPGKP---PNVFISK----------WFPQQAILAHPNVKLFITHGGLL 364
                       |..|    |.|   |..|:|:          |.||..||||..|..|:||.|..
plant   312 ACSAYLSANSGKIRD----GTPDYLPEGFVSRTHERGFMVSSWAPQAEILAHQAVGGFLTHCGWN 372

  Fly   365 STIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEF--RSTIIRLLTNKSFEET 427
            |.:||:..|.||:..|...:|..|...:.: .||:.:..|::.||..  |:.|..|:.....|| 
plant   373 SILESVVGGVPMIAWPLFAEQMMNATLLNE-ELGVAVRSKKLPSEGVITRAEIEALVRKIMVEE- 435

  Fly   428 ARITAARYRDQPMKPMETAIWWTEYVLSHKGAAH 461
               ..|..|.:..|..|||   .|.:....|.||
plant   436 ---EGAEMRKKIKKLKETA---AESLSCDGGVAH 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 106/489 (22%)
UDPGT 30..511 CDD:278624 106/489 (22%)
UGT72E1NP_566938.1 PLN02992 1..487 CDD:178572 106/489 (22%)
YjiC 5..479 CDD:224732 106/489 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.