DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT71B6

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_188815.2 Gene:UGT71B6 / 821732 AraportID:AT3G21780 Length:479 Species:Arabidopsis thaliana


Alignment Length:265 Identity:63/265 - (23%)
Similarity:99/265 - (37%) Gaps:84/265 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 FFPSVAERKPLSEISRNFDLVLVNQHFTLGP-----------PRPY-VPNMIQVGGLHVDHSTEA 271
            ||.:.|.|      .|....:|||....|.|           ||.| |..::.:..::.|: .:.
plant   194 FFVTQARR------FRETKGILVNTVPDLEPQALTFLSNGNIPRAYPVGPLLHLKNVNCDY-VDK 251

  Fly   272 LSAELDHFIQGAGESGVIYFSLGT-------NVKSKSLSEDRRKVLLETFASLPQRIVWKFE--- 326
            ..:|:..::.......|::...|:       .|:..:|:.||.          ..|.:|...   
plant   252 KQSEILRWLDEQPPRSVVFLCFGSMGGFSEEQVRETALALDRS----------GHRFLWSLRRAS 306

  Fly   327 --------------DELLP----------GKPPNVFISKWFPQQAILAHPNVKLFITHGGLLSTI 367
                          :|:||          ||     :..|..|.||||.|.:..|::|||..||:
plant   307 PNILREPPGEFTNLEEILPEGFFDRTANRGK-----VIGWAEQVAILAKPAIGGFVSHGGWNSTL 366

  Fly   368 ESIHHGKPMLGLPCLFDQ-FRNMDHVRQVGLGLVLNIKQ-------------MTSEEFRSTIIRL 418
            ||:..|.||...|...:| |...:.|.:  |||.:.||:             :|:||....||.|
plant   367 ESLWFGVPMAIWPLYAEQKFNAFEMVEE--LGLAVEIKKHWRGDLLLGRSEIVTAEEIEKGIICL 429

  Fly   419 LTNKS 423
            :...|
plant   430 MEQDS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 63/265 (24%)
UDPGT 30..511 CDD:278624 63/265 (24%)
UGT71B6NP_188815.2 PLN02554 1..473 CDD:215304 63/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.