DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT74F2

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_181910.1 Gene:UGT74F2 / 818986 AraportID:AT2G43820 Length:449 Species:Arabidopsis thaliana


Alignment Length:490 Identity:107/490 - (21%)
Similarity:181/490 - (36%) Gaps:145/490 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YFFALPYLKSLASLGHEITSVSPYPQREPFRNIHDIPVPEVFENFNEVLRIASTPRST------- 89
            :..|:||    .:.|| ||....:.:|..|:.:........|. ||.:....|.|.|.       
plant     7 HVLAVPY----PTQGH-ITPFRQFCKRLHFKGLKTTLALTTFV-FNSINPDLSGPISIATISDGY 65

  Fly    90 ----WQSSDFINEYVLNL----TKTVLNNEGVRRDILGPQKPH-----FDLVIMDL---WRMDVL 138
                ::::|.|::|:.:.    :||:       .||:  ||..     ...::.|.   |.:||.
plant    66 DHGGFETADSIDDYLKDFKTSGSKTI-------ADII--QKHQTSDNPITCIVYDAFLPWALDVA 121

  Fly   139 S--GLAA--YFDAP----IIGMASY----GTDWKIDELMGNVSPISYLQS-PSSRFYDLEAYGER 190
            .  ||.|  :|..|    .:...||    .....|:||     |...||. ||  |:.:..    
plant   122 REFGLVATPFFTQPCAVNYVYYLSYINNGSLQLPIEEL-----PFLELQDLPS--FFSVSG---- 175

  Fly   191 LLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPLSEISRNF---DLVLVNQH-------- 244
                     ||..|       .|.:..||.              ||   |.||||..        
plant   176 ---------SYPAY-------FEMVLQQFI--------------NFEKADFVLVNSFQELELHEN 210

  Fly   245 ---------FTLGP--PRPYVPNMIQVGGLHVDHSTEALSAELDHF----IQGAGESGVIYFSLG 294
                     .|:||  |..|:...|:   ....:......::.|.|    :....:..|:|.:.|
plant   211 ELWSKACPVLTIGPTIPSIYLDQRIK---SDTGYDLNLFESKDDSFCINWLDTRPQGSVVYVAFG 272

  Fly   295 -----TNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPG------KPPNVFISKWFPQQAI 348
                 |||:.:.|:.     .:..|:.|  .:|...|:|.||.      ......:.||.||..:
plant   273 SMAQLTNVQMEELAS-----AVSNFSFL--WVVRSSEEEKLPSGFLETVNKEKSLVLKWSPQLQV 330

  Fly   349 LAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQV-GLGLVLNIKQMTS---- 408
            |::..:..|:||.|..||:|::..|.||:.:|...||..|..:::.| ..|:.:..::.:.    
plant   331 LSNKAIGCFLTHCGWNSTMEALTFGVPMVAMPQWTDQPMNAKYIQDVWKAGVRVKTEKESGIAKR 395

  Fly   409 EEFRSTIIRLLTNKSFEETARITAARYRDQPMKPM 443
            ||...:|..::..:..:|..: ...::||..:|.:
plant   396 EEIEFSIKEVMEGERSKEMKK-NVKKWRDLAVKSL 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 107/490 (22%)
UDPGT 30..511 CDD:278624 107/490 (22%)
UGT74F2NP_181910.1 PLN02173 1..449 CDD:177830 107/490 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.