DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT73C2

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_181214.1 Gene:UGT73C2 / 818248 AraportID:AT2G36760 Length:496 Species:Arabidopsis thaliana


Alignment Length:533 Identity:100/533 - (18%)
Similarity:181/533 - (33%) Gaps:176/533 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPIFLLVCLLPGYSEGARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREPFRNIH 65
            :||:..:               :||..:..|....:...:.||..|..||.|:.......|:::.
plant    10 LPPLHFV---------------LFPFMAQGHMIPMVDIARILAQRGVTITIVTTPHNAARFKDVL 59

  Fly    66 D--------IPVPEVFENFNEVLRIASTPRSTWQSSDFIN--EYVLNLTKTVLNNEGVRRDILGP 120
            :        |.|..|...|.|     :..:...::.||::  |.:::..|.|...|.....::..
plant    60 NRAIQSGLHIRVEHVKFPFQE-----AGLQEGQENVDFLDSMELMVHFFKAVNMLENPVMKLMEE 119

  Fly   121 QKPHFDLVIMDLWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYLQSPSSRFYDLE 185
            .||....:|.| :.:...|.:|..|:.|.|                             .|:.:.
plant   120 MKPKPSCLISD-FCLPYTSKIAKRFNIPKI-----------------------------VFHGVS 154

  Fly   186 AYGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPLSEISRNFDLVLVNQHFTLGPP 250
            .:....:|::.|     |:...|..|.:..|. ..||..:|...:::.     |.|..:|: |..
plant   155 CFCLLSMHILHR-----NHNILHALKSDKEYF-LVPSFPDRVEFTKLQ-----VTVKTNFS-GDW 207

  Fly   251 RPYVPNMIQVG----GLHVDHSTEALSAELDHFIQG-AGESGVIYFSLGTNVKSKSLSEDRRK-- 308
            :..:...:...    |:.|:...:..||.:.::.:. ||:    .:|:|.......:.||:.:  
plant   208 KEIMDEQVDADDTSYGVIVNTFQDLESAYVKNYTEARAGK----VWSIGPVSLCNKVGEDKAERG 268

  Fly   309 ------------------------VLLETFASLP---------------QRIVW----------- 323
                                    |.|.:..:||               :..:|           
plant   269 NKAAIDQDECIKWLDSKDVESVLYVCLGSICNLPLAQLRELGLGLEATKRPFIWVIRGGGKYHEL 333

  Fly   324 -------KFEDELLPGKPPNVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPC 381
                   .||:..   |..::.|..|.||..||:||.|..|:||.|..||:|.|..|.|::..|.
plant   334 AEWILESGFEERT---KERSLLIKGWSPQMLILSHPAVGGFLTHCGWNSTLEGITSGVPLITWPL 395

  Fly   382 LFDQFRNMDHVRQV-------------------GLGLVLN---IKQMTSE---------EFRSTI 415
            ..|||.|...:.||                   .:|::::   :|:...|         |.|..:
plant   396 FGDQFCNQKLIVQVLKAGVSVGVEEVMKWGEEESIGVLVDKEGVKKAVDEIMGESDEAKERRKRV 460

  Fly   416 IRL--LTNKSFEE 426
            ..|  |.:|:.||
plant   461 RELGELAHKAVEE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 100/533 (19%)
UDPGT 30..511 CDD:278624 96/504 (19%)
UGT73C2NP_181214.1 Glycosyltransferase_GTB_type 13..495 CDD:299143 98/530 (18%)
YjiC 14..463 CDD:224732 93/517 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.