DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and AT2G31790

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_180738.1 Gene:AT2G31790 / 817736 AraportID:AT2G31790 Length:457 Species:Arabidopsis thaliana


Alignment Length:465 Identity:110/465 - (23%)
Similarity:187/465 - (40%) Gaps:115/465 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FPLPSSSHYFFALPYLKSLASLGHEITS---VSPYPQREPF---------RNIHD--IPVPEVFE 74
            ||.|...|....:...|.|:..|  |||   ::....|||:         ..|||  .|......
plant    12 FPYPLQGHINPMIQLAKRLSKKG--ITSTLIIASKDHREPYTSDDYSITVHTIHDGFFPHEHPHA 74

  Fly    75 NFNEVLRI-ASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRRDILGPQKPHFDLVI---MDLWRM 135
            .|.::.|. .||.||.   :|||       :...|::...:..|..|..| |.|.|   :||:  
plant    75 KFVDLDRFHNSTSRSL---TDFI-------SSAKLSDNPPKALIYDPFMP-FALDIAKDLDLY-- 126

  Fly   136 DVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYLQSPSSRFY---------DLEAYG-ER 190
                 :.|||..|.:....|   :.|:|...:| |:...::|:...:         ||.::. |:
plant   127 -----VVAYFTQPWLASLVY---YHINEGTYDV-PVDRHENPTLASFPGFPLLSQDDLPSFACEK 182

  Fly   191 ----LLH-LMERTFSYMNYKWRHVRKQETL----YSQFFPSVA----ERKPLSEISRNFDLVLVN 242
                ||| .:.|.||       ::.:.:.:    :.|..|.|.    ::.|:..|          
plant   183 GSYPLLHEFVVRQFS-------NLLQADCILCNTFDQLEPKVVKWMNDQWPVKNI---------- 230

  Fly   243 QHFTLGP--PRPYVPNMIQVGGLHVDHSTEALSAELDH----FIQGAGESGVIYFSLGTNVKSKS 301
                 ||  |..::.|.:..   ..|:..|....|.|.    ::.......|:|.:.||.|   :
plant   231 -----GPVVPSKFLDNRLPE---DKDYELENSKTEPDESVLKWLGNRPAKSVVYVAFGTLV---A 284

  Fly   302 LSEDRRKVLLETFASLPQRIVWKFEDELLPGKPPNVFI-----------SKWFPQQAILAHPNVK 355
            |||.:.|.:....:......:|... |....|.|:.||           :||.||..:|||.::.
plant   285 LSEKQMKEIAMAISQTGYHFLWSVR-ESERSKLPSGFIEEAEEKDSGLVAKWVPQLEVLAHESIG 348

  Fly   356 LFITHGGLLSTIESIHHGKPMLGLPCLFDQFRN---MDHVRQVGLGLVLNIKQMTS-EEFRSTII 416
            .|::|.|..||:|::..|.||:|:|...||..|   ::.|.::|:.:..:.:.::| ||....|:
plant   349 CFVSHCGWNSTLEALCLGVPMVGVPQWTDQPTNAKFIEDVWKIGVRVRTDGEGLSSKEEIARCIV 413

  Fly   417 RLLTNKSFEE 426
            .::..:..:|
plant   414 EVMEGERGKE 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 110/465 (24%)
UDPGT 30..511 CDD:278624 107/459 (23%)
AT2G31790NP_180738.1 Glycosyltransferase_GTB_type 3..454 CDD:299143 110/465 (24%)
YjiC 6..454 CDD:224732 110/465 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.