DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT87A2

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_180575.1 Gene:UGT87A2 / 817566 AraportID:AT2G30140 Length:455 Species:Arabidopsis thaliana


Alignment Length:427 Identity:89/427 - (20%)
Similarity:165/427 - (38%) Gaps:97/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREPFRNIHDIPVPEVFENFNEVLRIASTPRST 89
            |.|...| |..||.|     :..|:.      :.:.|....|.....:.|.|.::|...::|.  
plant    60 PKPDRIH-FSTLPNL-----IPSELV------RAKDFIGFIDAVYTRLEEPFEKLLDSLNSPP-- 110

  Fly    90 WQSSDFINEYVLNLTKTVLNNEGVRRDILGPQKPHFDLVIMDLWRMDVLSGLAAYFDAPIIGMAS 154
             .|..|.:.||:...:.     |.:|:|          .::.||.|.. :.|:.:..:.:  :.|
plant   111 -PSVIFADTYVIWAVRV-----GRKRNI----------PVVSLWTMSA-TILSFFLHSDL--LIS 156

  Fly   155 YG------TDWKIDELMGNVSPISYLQSPSSRFYDLEAYGERLLHLMERTFSYMNYKWRHVRKQE 213
            :|      ::.::.:.:..:||......|..    .:.|.:|:....:..|..:      ...:.
plant   157 HGHALFEPSEEEVVDYVPGLSPTKLRDLPPI----FDGYSDRVFKTAKLCFDEL------PGARS 211

  Fly   214 TLYSQFFPSVAERKPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDH 278
            .|::..:.  .|.|.:...:...|:.:    :.:||..|:                |.||.:.|:
plant   212 LLFTTAYE--LEHKAIDAFTSKLDIPV----YAIGPLIPF----------------EELSVQNDN 254

  Fly   279 -------FIQGAGESGVIYFSLGTNVKSKSLSEDRRKVLLETFASLPQRIVW-------KFEDEL 329
                   :::...|..|:|.|.|:.:   |:||.:.:.:::.......|.:|       |.: |.
plant   255 KEPNYIQWLEEQPEGSVLYISQGSFL---SVSEAQMEEIVKGLRESGVRFLWVARGGELKLK-EA 315

  Fly   330 LPGKPPNVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQ 394
            |.|. ..|.:| |..|..:|.|..|..|.||.|..||:|.|:.|.|||..|..:||..|...:.:
plant   316 LEGS-LGVVVS-WCDQLRVLCHKAVGGFWTHCGFNSTLEGIYSGVPMLAFPLFWDQILNAKMIVE 378

  Fly   395 ---VGLGLVLNIKQ---MTSEEFRSTIIRLLTNKSFE 425
               ||:.:....|.   :..||.:..:.|.:..:|.|
plant   379 DWRVGMRIERTKKNELLIGREEIKEVVKRFMDRESEE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 89/427 (21%)
UDPGT 30..511 CDD:278624 87/422 (21%)
UGT87A2NP_180575.1 PLN02448 2..455 CDD:215247 89/427 (21%)
YjiC 13..450 CDD:224732 89/427 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.