DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT84B1

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_179907.1 Gene:UGT84B1 / 816858 AraportID:AT2G23260 Length:456 Species:Arabidopsis thaliana


Alignment Length:247 Identity:60/247 - (24%)
Similarity:92/247 - (37%) Gaps:78/247 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 PISYLQSPSSRFYDLEA-YGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPLSEIS 233
            |...|.|..:.||:|.| :.:.|.::          ||..|.....|.|:...|:|:.||:..|.
plant   175 PSFMLPSGGAHFYNLMAEFADCLRYV----------KWVLVNSFYELESEIIESMADLKPVIPIG 229

  Fly   234 RNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAE-LD---------HFIQGAGESGV 288
                 .||:. |.||                 |...|.|..: ||         .::.....|.|
plant   230 -----PLVSP-FLLG-----------------DGEEETLDGKNLDFCKSDDCCMEWLDKQARSSV 271

  Fly   289 IYFSLGTNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLP--------GKPPNV-------- 337
            :|.|.|:              :|||..:..:.|....::..||        .|..||        
plant   272 VYISFGS--------------MLETLENQVETIAKALKNRGLPFLWVIRPKEKAQNVAVLQEMVK 322

  Fly   338 ----FISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQ 385
                .:.:|.||:.||:|..:..|:||.|..||:|::..|.|::..|...||
plant   323 EGQGVVLEWSPQEKILSHEAISCFVTHCGWNSTMETVVAGVPVVAYPSWTDQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 60/247 (24%)
UDPGT 30..511 CDD:278624 60/247 (24%)
UGT84B1NP_179907.1 PLN02210 1..456 CDD:215127 60/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.