DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and AT2G16890

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_179281.3 Gene:AT2G16890 / 816190 AraportID:AT2G16890 Length:478 Species:Arabidopsis thaliana


Alignment Length:492 Identity:116/492 - (23%)
Similarity:180/492 - (36%) Gaps:124/492 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCLLPGYSEG--------ARIL------------AVFPLPSSSHYFFALPYLKSLASLGHEITSV 52
            |.|.|..|:|        .|:|            .||..|.:.      |::....|...||..:
plant    10 VVLFPFMSKGHIIPLLQFGRLLLRHHRKEPTITVTVFTTPKNQ------PFISDFLSDTPEIKVI 68

  Fly    53 S-PYPQREPFRNIHDIPVPEVFENFNEV----LRIASTPRSTWQSSDFINEYVLNLTKTVLNNEG 112
            | |:|:     ||..|| |.| ||..::    |.:..| |:|.....|..|.:..|         
plant    69 SLPFPE-----NITGIP-PGV-ENTEKLPSMSLFVPFT-RATKLLQPFFEETLKTL--------- 116

  Fly   113 VRRDILGPQKPHFDLVIMD--LWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYLQ 175
                      |....::.|  ||   ..|..||.|:.|  ...|||.:             ||..
plant   117 ----------PKVSFMVSDGFLW---WTSESAAKFNIP--RFVSYGMN-------------SYSA 153

  Fly   176 SPSSRFYDLEAYGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFP---SVAERKPLSEI----- 232
            :.|...:..|.:.|..........:..::.|..|:|.:..:....|   ..|....:.:|     
plant   154 AVSISVFKHELFTEPESKSDTEPVTVPDFPWIKVKKCDFDHGTTEPEESGAALELSMDQIKSTTT 218

  Fly   233 SRNFDLVLVNQHFTLGPPRPYV---------PNMIQVGGLHVDHSTEALSAE--LDHFIQGAGES 286
            |..|   |||..:.|  ...:|         |....||.|.:....:..||:  ..|::....|.
plant   219 SHGF---LVNSFYEL--ESAFVDYNNNSGDKPKSWCVGPLCLTDPPKQGSAKPAWIHWLDQKREE 278

  Fly   287 G--VIYFSLGT--NVKSKSLSE-----DRRKV--LLETFASLPQRIVWKFEDELLPGKPPNVFIS 340
            |  |:|.:.||  .:.:|.|.|     :..||  |..|...:.:.|...|.|.:   :...:.:.
plant   279 GRPVLYVAFGTQAEISNKQLMELAFGLEDSKVNFLWVTRKDVEEIIGEGFNDRI---RESGMIVR 340

  Fly   341 KWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDH-VRQVGLGLVLNIK 404
            .|..|..||:|.:||.|::|.|..|..|||..|.|:|..|.:.:|..|... |.::.:|:.:..:
plant   341 DWVDQWEILSHESVKGFLSHCGWNSAQESICVGVPLLAWPMMAEQPLNAKMVVEEIKVGVRVETE 405

  Fly   405 Q------MTSEEFRSTIIRLLTNKSFEETARITAARY 435
            .      :|.||....|..|:..:: .:|||.....|
plant   406 DGSVKGFVTREELSGKIKELMEGET-GKTARKNVKEY 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 116/492 (24%)
UDPGT 30..511 CDD:278624 106/450 (24%)
AT2G16890NP_179281.3 Glycosyltransferase_GTB_type 9..467 CDD:299143 116/492 (24%)
YjiC 9..440 CDD:224732 115/489 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.