DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and ugt2b6

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001170806.2 Gene:ugt2b6 / 792506 ZFINID:ZDB-GENE-100402-4 Length:527 Species:Danio rerio


Alignment Length:551 Identity:147/551 - (26%)
Similarity:261/551 - (47%) Gaps:69/551 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPIFLLVCLLPGYSEG--ARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSP--------- 54
            |.|:...:.||...|.|  ..:|..|  ...||:......|::|...||::|.:.|         
Zfish     1 MRPLACFLSLLSLLSAGECGNVLVWF--TEGSHWINMKIVLETLIDRGHDVTVLVPDASLFMKAN 63

  Fly    55 ------YPQREPFRNIHDIPVPEVF-ENF-------NEVLRIASTPRSTWQSSDFINEYVLNLTK 105
                  |   :||....|....:|| |.|       .:.|.........::.:..:.:..::...
Zfish    64 ASDRFSY---QPFNVSMDEQEMKVFIEEFLYFSLYEMDQLNFFQMQSKVYEFTSKLQDMSISYCD 125

  Fly   106 TVLNNEGVRRDILGPQKPHFDLVIMD-LWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNV- 168
            .||.:.|:...:   :|..||:|..| :::...:  :|...:.|::....:......:.:.|.: 
Zfish   126 GVLKSPGLLDKL---RKHKFDVVFSDPIYQCSDI--VAEELNVPLVYTFRFSLAHAAERMCGQIP 185

  Fly   169 SPISYLQSPSSRFYDLEAYGER----LLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPL 229
            :|.||:....|:..|..::.||    |.:|.:..|:.  :.|   :|.:..|:::|     .:|.
Zfish   186 APPSYVPGAMSKLTDKMSFTERIYNMLFYLSQDAFAI--FAW---KKIDNYYTEYF-----GRPT 240

  Fly   230 S--EISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFS 292
            |  |:....|:.|:..::....|||:|||...:||||.. ..:.|..:::.|:|.:||.|::.|:
Zfish   241 SYCEMMGRADIWLIRTYWDFEFPRPFVPNFKYIGGLHCT-PAKPLPKDMEEFVQSSGEDGIVVFT 304

  Fly   293 LGTNVKS--KSLSEDRRKVLLETFASLPQRIVWKFEDELLPGKP----PNVFISKWFPQQAILAH 351
            ||:.|..  |.:|..    :....|.:||:::|::..|    ||    .|..|.||.||..:|.|
Zfish   305 LGSLVGKVPKEISNR----IASALAQIPQKVLWRYGGE----KPDTLGENTRIYKWIPQNDLLGH 361

  Fly   352 PNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVL-NIKQMTSEEFRSTI 415
            |..:.||||||.....|:|:||.||:|:|...||..||.|:...|..:|: :||.|..:|....:
Zfish   362 PKTRAFITHGGTNGVYEAIYHGVPMVGIPLFGDQPDNMVHMTTRGAAVVVDSIKSMQPQELVDKL 426

  Fly   416 IRLLTNKSFEETARITAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHSLDVF 480
            ..::.:.|::|.|...:..:.|:||||::.:::|.|:|:.:|||.|::|...:|.:.:||.||||
Zfish   427 NTVINDPSYKENAMRLSRIHHDRPMKPLDESVFWIEFVMRNKGAKHLRVEAHNLTWYQYHCLDVF 491

  Fly   481 GTFLVGALVILGIVTYLLVMTLRKCLFLIKR 511
            ........::|.|...:....:.:|.|..||
Zfish   492 AFLTTVLTLVLYICFKMAKFFIMRCCFRSKR 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 132/500 (26%)
UDPGT 30..511 CDD:278624 137/518 (26%)
ugt2b6NP_001170806.2 UDPGT 20..523 CDD:278624 141/532 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55988
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.