DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT8

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001121646.2 Gene:UGT8 / 7368 HGNCID:12555 Length:541 Species:Homo sapiens


Alignment Length:538 Identity:143/538 - (26%)
Similarity:255/538 - (47%) Gaps:59/538 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PIFLLVCLLPGYSEGARILAVFPLPSSSH-YFFALPYLKSLASLGHE--------------ITSV 52
            |.|:|:....|.::.|:|:.|.|:...|| |.|     |:|||..||              |...
Human     6 PYFILLWSAVGIAKAAKIIIVPPIMFESHMYIF-----KTLASALHERGHHTVFLLSEGRDIAPS 65

  Fly    53 SPYP-QREPFRNIHDIPVPEVFENFNEVLRIASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRRD 116
            :.|. ||.|  .|.:....:.|.. :::..|.|...:..:..|.::.|..|....|.|:..::  
Human    66 NHYSLQRYP--GIFNSTTSDAFLQ-SKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQ-- 125

  Fly   117 ILGPQKPHFDLVIMDLWRMDVLSGLAAYFDAPIIGM--ASYGTDWKIDELMGNVSPISYLQSPSS 179
              |.:|..|||:::|      .:.:..:..|.::|:  |.:.|.......:|..:|::|:...:|
Human   126 --GLKKEKFDLLLVD------PNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNS 182

  Fly   180 RFYDLEAYGERLLHLMERT----FSYMNYKWRHVRKQETLYSQFFPSVAERKPLSEISRNFDLVL 240
            ...|    ...||..|:.|    .|.:...:..:.|.|.:..::  ::...|.:.::.....|.:
Human   183 LLTD----RMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKY--NLLPEKSMYDLVHGSSLWM 241

  Fly   241 VNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGTNVKSKSLSED 305
            :.....|..|||.:||::.|||: :......|..:|..::.||.|.|.:..|.|..|  |.||||
Human   242 LCTDVALEFPRPTLPNVVYVGGI-LTKPASPLPEDLQRWVNGANEHGFVLVSFGAGV--KYLSED 303

  Fly   306 RRKVLLETFASLPQRIVWKFEDELLPGKPP-----NVFISKWFPQQAILAHPNVKLFITHGGLLS 365
            ....|......|||:::|:|.     |..|     |..:.:|.||..:|.|..:|.|::||||.|
Human   304 IANKLAGALGRLPQKVIWRFS-----GPKPKNLGNNTKLIEWLPQNDLLGHSKIKAFLSHGGLNS 363

  Fly   366 TIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEETARI 430
            ..|:|:||.|::|:|...|.:..|..|:..|:|::|..|.:|.:|....:::::.|.|:.:.|:.
Human   364 IFETIYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKTVTEKELYEALVKVINNPSYRQRAQK 428

  Fly   431 TAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHSLDVFGTFLVGALVILGIVT 495
            .:..::|||..|:...|:|.:|::.|.||.|::.|...:.|.:|..||:....|:||.::..:::
Human   429 LSEIHKDQPGHPVNRTIYWIDYIIRHNGAHHLRAAVHQISFCQYFLLDIAFVLLLGAALLYFLLS 493

  Fly   496 YLLVMTLRKCLFLIKRGK 513
            ::.....||...|..|.|
Human   494 WVTKFIYRKIKSLWSRNK 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 129/485 (27%)
UDPGT 30..511 CDD:278624 133/507 (26%)
UGT8NP_001121646.2 Glycosyltransferase_GTB-type 21..502 CDD:415824 134/512 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150669
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - mtm8458
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.