DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT2B17

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001068.1 Gene:UGT2B17 / 7367 HGNCID:12547 Length:530 Species:Homo sapiens


Alignment Length:561 Identity:153/561 - (27%)
Similarity:270/561 - (48%) Gaps:94/561 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFLLVCLLPGYSEGA--RILAVFPLPSSSHYFFALPYLKSLASLGHEI----------------- 49
            :|||:.|...:|.|:  ::| |:| ...||:......|:.|...|||:                 
Human     8 VFLLMQLSCYFSSGSCGKVL-VWP-TEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSS 70

  Fly    50 --------TSVSPYPQREPFRNIHDIPVPEVFEN-----FNEVLRIASTPRSTWQSSDFINEYVL 101
                    ||::.....:.|..:.|.....:.:|     |:::..:.      |:.||    |.:
Human    71 AIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELC------WEYSD----YNI 125

  Fly   102 NLTKTVLNNEGVRRDILGPQKPHFDLVIMDLWRMDVLSG--LAAYFDAPIIGMASYGTDWKIDEL 164
            .|.:..:.|:.:.|.:   |:..||:::.|....   .|  ||...:.|.:....:...:.:::.
Human   126 KLCEDAVLNKKLMRKL---QESKFDVLLADAVNP---CGELLAELLNIPFLYSLRFSVGYTVEKN 184

  Fly   165 MGN-VSPISYLQSPSSRFYDLEAYGER---LLHLMERTFSYMNY---KWRHVRKQETLYSQFFPS 222
            .|. :.|.||:....|...|...:.||   :::::...|.:..|   ||          .||:..
Human   185 GGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKW----------DQFYSE 239

  Fly   223 VAER-KPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGES 286
            |..| ..|.|.....::.|:..::....|||::||:..|||||. ...:.|..|::.|:|.:||:
Human   240 VLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHC-KPAKPLPKEMEEFVQSSGEN 303

  Fly   287 GVIYFSLGTNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPGKPPNVF-----ISKWFPQQ 346
            |::.||||:.:  .::||:...::....|.:||:::|:|:     ||.||..     :.||.||.
Human   304 GIVVFSLGSMI--SNMSEESANMIASALAQIPQKVLWRFD-----GKKPNTLGSNTRLYKWLPQN 361

  Fly   347 AILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEF 411
            .:|.||..|.||||||.....|:|:||.||:|:|...||..|:.|::..|..|.::|:.|:|.:.
Human   362 DLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDL 426

  Fly   412 RSTIIRLLTNKSFEETARITAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHS 476
            .:.:..::.:..::|.....:..:.|||:||::.|::|.|:|:.||||.|::||..:|.:::|||
Human   427 LNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHS 491

  Fly   477 LDVFGTFLVGALVILGIVTYLLVMTLRKCLF----LIKRGK 513
            |||..       .:|..|..::.|..:.|||    |.|.||
Human   492 LDVIA-------FLLACVATMIFMITKCCLFCFRKLAKTGK 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 133/504 (26%)
UDPGT 30..511 CDD:278624 141/529 (27%)
UGT2B17NP_001068.1 UDPGT 24..518 CDD:278624 143/536 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150255
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - mtm8458
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.690

Return to query results.
Submit another query.