DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT2B10

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001066.1 Gene:UGT2B10 / 7365 HGNCID:12544 Length:528 Species:Homo sapiens


Alignment Length:518 Identity:150/518 - (28%)
Similarity:254/518 - (49%) Gaps:76/518 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LKSLASLGHEIT------------------SVSPYP---QREPFRNIHDIPVPEVFENFNEV--- 79
            ||.|...|||:|                  .:..||   .:..|.||    :.::.:..:|:   
Human    42 LKELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTSLTKTEFENI----IMQLVKRLSEIQKD 102

  Fly    80 ---LRIASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRRDILGPQKPHFDLVIMDLWRMDVLSGL 141
               |..:......|.    ||:.:.|..|.|::|:.:.:.:   |:..||:|..|.: :.....|
Human   103 TFWLPFSQEQEILWA----INDIIRNFCKDVVSNKKLMKKL---QESRFDIVFADAY-LPCGELL 159

  Fly   142 AAYFDAPIIGMASYGTDWKIDELMGN-VSPISYLQSPSSRFYDLEAYGERLLHLMERTFSYMNY- 204
            |..|:.|.:...|:...:..:...|. :.|.||:....|:..|...:.||:.:::     |:.| 
Human   160 AELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERVKNML-----YVLYF 219

  Fly   205 -KWRHVRKQETLYSQFFPSVAER-KPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDH 267
             .|..:...:. :.||:..|..| ..|||..|..|:.|:...:....|.|::||:..|||||. .
Human   220 DFWFQIFNMKK-WDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHC-K 282

  Fly   268 STEALSAELDHFIQGAGESGVIYFSLGTNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPG 332
            ..:.|..|::.|:|.:||:||:.||||:.|  .:::|:|..|:....|.:||:::|:|:     |
Human   283 PAKPLPKEMEEFVQSSGENGVVVFSLGSMV--SNMTEERANVIATALAKIPQKVLWRFD-----G 340

  Fly   333 KPP-----NVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHV 392
            ..|     |..:.||.||..:|.||..:.||||||.....|:|:||.||:|:|..|||..|:.|:
Human   341 NKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHM 405

  Fly   393 RQVGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEETARITAARYRDQPMKPMETAIWWTEYVLSHK 457
            :..|..:.::...|:|.:..:.:..::.:.|::|.....:....|||:||::.|::|.|:|:.||
Human   406 KAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHK 470

  Fly   458 GAAHMQVAGKDLGFVRYHSLDVFGTFLVGALVILGIVTYLLVMTLRKCLFLI-------KRGK 513
            ||.|::||..:|.:.:||||||.|..|.....:|.|:|       :.|||..       |:||
Human   471 GAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIIT-------KCCLFCFWKFARKGKKGK 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 129/458 (28%)
UDPGT 30..511 CDD:278624 147/514 (29%)
UGT2B10NP_001066.1 UDPGT 23..524 CDD:278624 147/514 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150481
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - mtm8458
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.690

Return to query results.
Submit another query.