DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT2B7

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001065.2 Gene:UGT2B7 / 7364 HGNCID:12554 Length:529 Species:Homo sapiens


Alignment Length:529 Identity:153/529 - (28%)
Similarity:249/529 - (47%) Gaps:80/529 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SHYFFALPYLKSLASLGHEIT------SVSPYPQREPFRNIHDIP---VPEVFENF--NEVLRIA 83
            ||:......|..|...|||:|      |:...|.......|...|   .....|||  .::.|.:
Human    34 SHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWS 98

  Fly    84 STPRST-W-------QSSDFINEYVLNLTKTVLNNEGVRRDILGPQKPHFDLVIMD-LWRMDVLS 139
            ..|:.| |       :......:......|.|::|:...:.:   |:..||::..| ::....| 
Human    99 DLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKV---QESRFDVIFADAIFPCSEL- 159

  Fly   140 GLAAYFDAPIIGMASYGTDWKIDELMGN-VSPISYLQSPSSRFYDLEAYGERLLHLMERTFSYMN 203
             ||..|:.|.:...|:...:..::..|. :.|.||:....|...|...:.||:.:::     |:.
Human   160 -LAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMI-----YVL 218

  Fly   204 Y-----------KWRHVRKQETLYSQFFPSVAER-KPLSEISRNFDLVLVNQHFTLGPPRPYVPN 256
            |           ||          .||:..|..| ..|||.....|:.|:...:....|.|.:||
Human   219 YFDFWFEIFDMKKW----------DQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPN 273

  Fly   257 MIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGTNVKSKSLSEDRRKVLLETFASLPQRI 321
            :..|||||. ...:.|..|::.|:|.:||:||:.||||:.|  .:::|:|..|:....|.:||::
Human   274 VDFVGGLHC-KPAKPLPKEMEDFVQSSGENGVVVFSLGSMV--SNMTEERANVIASALAQIPQKV 335

  Fly   322 VWKFEDELLPGKPP-----NVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPC 381
            :|:|:     |..|     |..:.||.||..:|.||..:.||||||.....|:|:||.||:|:|.
Human   336 LWRFD-----GNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPL 395

  Fly   382 LFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEETARITAARYRDQPMKPMETA 446
            ..||..|:.|::..|..:.::...|:|.:..:.:.|::.:.|::|.....:....|||:||::.|
Human   396 FADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRA 460

  Fly   447 IWWTEYVLSHKGAAHMQVAGKDLGFVRYHSLDVFGTFLVGALVILGIVTYLLVMTLRKCLFLI-- 509
            ::|.|:|:.||||.|::||..||.:.:||||||.|..||....::.|||       :.|||..  
Human   461 VFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVT-------KCCLFCFWK 518

  Fly   510 -----KRGK 513
                 |:||
Human   519 FARKAKKGK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 130/469 (28%)
UDPGT 30..511 CDD:278624 150/525 (29%)
UGT2B7NP_001065.2 UDPGT 24..525 CDD:278624 150/525 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150431
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - mtm8458
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.690

Return to query results.
Submit another query.