DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and LOC571561

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_021332080.1 Gene:LOC571561 / 571561 -ID:- Length:206 Species:Danio rerio


Alignment Length:222 Identity:44/222 - (19%)
Similarity:88/222 - (39%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVC---LLPGYSEG--ARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREPFRNIH 65
            |:||   ||..:|.|  ..:|..|  ...||:......|::|...||.:|.:             
Zfish     3 LVVCVLALLTAFSAGECGNVLVWF--TEGSHWINLKIVLETLIDRGHNVTVL------------- 52

  Fly    66 DIPVPEVFENFNEVLRIA----STPRSTWQSSDFINEYV---------LNLTKTVLN-NEGVRRD 116
             :|...:|.:..|..|.:    |..:||....|.:|:::         |||.:..:. .:.:.:|
Zfish    53 -VPDASIFMHEKESDRFSYQHFSVSKSTQDMQDSLNDFLHFSMYEMDRLNLLQIHIRLYQLISKD 116

  Fly   117 -----------ILGPQ------KPHFDLVIMD-LWRMDVLSGLAAYFDAPIIGMASYGTDWKIDE 163
                       :..|:      :..||:::.| ::....:  ||...|.|::....:.....::.
Zfish   117 QQLCLAYCNGALKSPELMDKLLQEKFDVMLADPIFPCSEV--LAEKLDIPLVYTLRFSIAHTMER 179

  Fly   164 LMGNV-SPISYLQSPSSRFYDLEAYGE 189
            :.|.: :|:||:....|:..|..::.|
Zfish   180 MCGQIPAPLSYVPGAISKLTDKMSFTE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 44/222 (20%)
UDPGT 30..511 CDD:278624 35/193 (18%)
LOC571561XP_021332080.1 UDPGT 20..>206 CDD:330975 36/203 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55988
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.