DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT1A1

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_000454.1 Gene:UGT1A1 / 54658 HGNCID:12530 Length:533 Species:Homo sapiens


Alignment Length:545 Identity:154/545 - (28%)
Similarity:261/545 - (47%) Gaps:64/545 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVCLL-PGYSEGARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSP----YPQREPFRNIH 65
            ||:|:| |..|...:||.: |: ..||:...|..::.|...||||..::|    |.:...|..:.
Human    15 LLLCVLGPVVSHAGKILLI-PV-DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLK 77

  Fly    66 DIPVP---------------EVFENFNEVLRIASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRR 115
            ..|||               .||||.:.:.|:..|.:...:.|..:    |:....:|:|:.:..
Human    78 TYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAML----LSGCSHLLHNKELMA 138

  Fly   116 DILGPQKPHFDLVIMDLWRMDVLSGLAAYFDAPIIGMASYGTDWKID-ELMGNVSPISYLQSPSS 179
            .:   .:..||:::.|.: :.....:|.|...|.: ...:.....:: |.....:|.||:..|.|
Human   139 SL---AESSFDVMLTDPF-LPCSPIVAQYLSLPTV-FFLHALPCSLEFEATQCPNPFSYVPRPLS 198

  Fly   180 RFYDLEAYGERLLHLMERTFS--------YMNYKWRHVRKQETLYSQFFP-SVAERKPLSEISRN 235
            ...|...:.:|:.::: ..||        |..|        .||.|:|.. .|..:..||..|  
Human   199 SHSDHMTFLQRVKNML-IAFSQNFLCDVVYSPY--------ATLASEFLQREVTVQDLLSSAS-- 252

  Fly   236 FDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGTNVKSK 300
              :.|....|....|||.:|||:.|||::..|. ..||.|.:.:|..:||.|::.||||:.|  .
Human   253 --VWLFRSDFVKDYPRPIMPNMVFVGGINCLHQ-NPLSQEFEAYINASGEHGIVVFSLGSMV--S 312

  Fly   301 SLSEDRRKVLLETFASLPQRIVWKFEDELLPGKPPNVFISKWFPQQAILAHPNVKLFITHGGLLS 365
            .:.|.:...:.:....:||.::|::..........|..:.||.||..:|.||..:.||||.|...
Human   313 EIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHG 377

  Fly   366 TIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEETARI 430
            ..|||.:|.||:.:|...||..|...:...|.|:.||:.:||||:..:.:..::.:||::|....
Human   378 VYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMR 442

  Fly   431 TAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHSLDVFGTFLVGALVILGIVT 495
            .::.::|:|::|::.|::|.|:|:.||||.|::.|..||.:.:||||||.| ||:..::.:..:|
Human   443 LSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG-FLLAVVLTVAFIT 506

  Fly   496 Y-LLVMTLRKCLFLIKRGKCEAIKK 519
            : ......||||     ||...:||
Human   507 FKCCAYGYRKCL-----GKKGRVKK 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 132/485 (27%)
UDPGT 30..511 CDD:278624 141/510 (28%)
UGT1A1NP_000454.1 UDPGT 28..524 CDD:278624 146/528 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150309
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - mtm8458
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.690

Return to query results.
Submit another query.