DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and Ugt1a6b

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_958812.3 Gene:Ugt1a6b / 394435 MGIID:3580629 Length:531 Species:Mus musculus


Alignment Length:551 Identity:148/551 - (26%)
Similarity:255/551 - (46%) Gaps:88/551 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVCLLPGYSE---------------GARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSP-- 54
            :.||||....               |.::|.| | ...||:......::.|:..||:|..:.|  
Mouse     1 MACLLPAAQTLPAGFLFLVLWASVLGDKLLVV-P-QDGSHWLSMKEIVEHLSERGHDIVVLVPEV 63

  Fly    55 --------YPQREPFRNIHDIPVPEVFENFNEVLRIASTPRSTWQSSDFI---------NEY--- 99
                    |.:|:.|      .||...|......|       |:..:.|:         .||   
Mouse    64 NLLLGESKYYRRKIF------SVPYSLEELQTRFR-------TFGRNQFVPGAPLMGPLREYRNS 115

  Fly   100 VLNLTKTVLNNEGVRRD-----ILGPQKPHFDLVIMD-LWRMDVLSGLAAYFDAPIIGMASYGTD 158
            :|.|.....|.:.:.:|     .|...|  ||.:..| .....|:  ||.|.:.|.:.:.. |..
Mouse   116 MLTLEMFFSNCQSLLKDSATLSFLRENK--FDALFTDPAMPCGVI--LAEYLNLPSVYLFR-GFP 175

  Fly   159 WKIDELMG-NVSPISYLQSPSSRFYDLEAYGERL----LHLMERTFSYMNYKWRHVRKQETLYSQ 218
            ..::.::| :.||:||:....::|.|...:.:||    ::::|   :|:.|         .|||:
Mouse   176 CSLEHMLGQSPSPVSYVPRFYTKFSDHMTFPQRLANFIVNILE---NYLYY---------CLYSK 228

  Fly   219 FFPSVAE--RKPLS--EISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHF 279
            :...|.:  ::.:|  .:.:| .|.|:...|....|||.:||||.:||::.....: |:.|.:.:
Mouse   229 YEIIVTDLLKRDVSLPSLHQN-SLWLLRYDFVFEYPRPIMPNMIFIGGINCKKKGK-LTQEFEAY 291

  Fly   280 IQGAGESGVIYFSLGTNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPGKPPNVFISKWFP 344
            :..:||.|::.||||:.|  ..:.|.:...:.|....:||.::|::..........|..:.||.|
Mouse   292 VNASGEHGIVVFSLGSMV--SEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLP 354

  Fly   345 QQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSE 409
            |..:|.||..:.||||.|.....|.|.:|.||:.:|...||..|...:...|.|:.||:.:||::
Mouse   355 QNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTAD 419

  Fly   410 EFRSTIIRLLTNKSFEETARITAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRY 474
            :..:.:..::.|||::|.....::.::|:|::|::.|::|.|||:.||||.|::.|..||.:.:|
Mouse   420 DLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQY 484

  Fly   475 HSLDVFGTFLVGALVILGIVTYLLVMTLRKC 505
            |||||.|..|...|.::.||........|||
Mouse   485 HSLDVIGFLLAIVLTVVFIVFKCCAYGCRKC 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 130/506 (26%)
UDPGT 30..511 CDD:278624 140/513 (27%)
Ugt1a6bNP_958812.3 egt 15..503 CDD:223071 139/523 (27%)
UDPGT 27..522 CDD:278624 143/525 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840672
Domainoid 1 1.000 259 1.000 Domainoid score I1975
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 272 1.000 Inparanoid score I2975
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - otm42461
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.690

Return to query results.
Submit another query.