DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:410 Identity:123/410 - (30%)
Similarity:203/410 - (49%) Gaps:49/410 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RRDILGPQK-PHFDLVIMDLWRMDVLSGLA--------AYFDAPIIGMASYGTDWKIDELMGNVS 169
            |:||:...| .:||||:.:  .:|..|.|.        ..|.|..:|.    .|:::..:     
  Rat    57 RKDIMEFLKNANFDLVLFE--SVDYCSSLIVEKLGKQFVLFLAFQLGF----MDFELQRV----- 110

  Fly   170 PISYLQSPSSRFYDLEAYGERLLHLME---RTFSYMNYKWRHVRKQETLYSQFFPSVAE------ 225
            |:||          :..||..|...|:   |..:::.: :...|||..:.||:..::.|      
  Rat   111 PLSY----------VPVYGSGLTDQMDFWGRVKNFLMF-FDLSRKQREILSQYDSTIQEHFAEGS 164

  Fly   226 RKPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIY 290
            |..||::....:|..||..|.....||..||::.|||| :|...:::..:|::||...|:||.:.
  Rat   165 RPVLSDLLLKAELWFVNCDFAFEFARPLFPNIVYVGGL-LDKPVQSIPQDLENFITQFGDSGFVL 228

  Fly   291 FSLGTNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPGK---PPNVFISKWFPQQAILAHP 352
            .:||| |.:|..:::..|.:...||.|||.::|..:|...|..   .|||.|..|.||..:||||
  Rat   229 VALGT-VATKFQTKEIIKEMNNAFAHLPQGVIWACKDSHWPKDVTLAPNVKIMDWLPQTDLLAHP 292

  Fly   353 NVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTIIR 417
            :::||:||||:.|..|:|.||.||:|:....||..||..|....:|:.:.|:.:.:|.|..|:..
  Rat   293 SIRLFVTHGGMNSVNEAIQHGVPMVGILFFSDQPENMIRVEAKTIGVSIQIQTLKAETFARTMKE 357

  Fly   418 LLTNKSFEETARITAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHSLDVFGT 482
            ::.:|.::..|..:.......|:.|.:....|.:::|...||||::.......:...:.|||| .
  Rat   358 VIEDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHILQTGGAAHLKPYAFQQPWHEQYLLDVF-L 421

  Fly   483 FLVGALVILGIVTYLLVMTL 502
            ||:|  :.||.| :|.|..|
  Rat   422 FLLG--LTLGTV-WLCVKVL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 109/368 (30%)
UDPGT 30..511 CDD:278624 123/410 (30%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 111/385 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.