DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1607 and SLC7A14

DIOPT Version :9

Sequence 1:NP_001263139.1 Gene:CG1607 / 43707 FlyBaseID:FBgn0039844 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_066000.2 Gene:SLC7A14 / 57709 HGNCID:29326 Length:771 Species:Homo sapiens


Alignment Length:448 Identity:102/448 - (22%)
Similarity:186/448 - (41%) Gaps:93/448 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SIVNGNGDASAKLTNGDGDGGGDGGGEVTLKAKMSLLNGCTVIVGSIIGSGIFVSPTGVLMYTGS 80
            |::.|.|..:|..|.              |...::.::..::.|||.:|:|::| .:|::....:
Human    34 SMLEGTGTTTAHGTK--------------LAQVLTTVDLISLGVGSCVGTGMYV-VSGLVAKEMA 83

  Fly    81 VNLALIVWVISGLFSMVGAYCYAELGTMITK-SGADYAYIMETFGPFMAFIRLW---IECMIVRP 141
            ....::.::|:.:.|::...||||.|..:.| :|:.|.|...|.|.|:||...|   :|.:|...
Human    84 GPGVIVSFIIAAVASILSGVCYAEFGVRVPKTTGSAYTYSYVTVGEFVAFFIGWNLILEYLIGTA 148

  Fly   142 CSQAIVALTF---STYVLKPFFPECT--------PPEDSARLLAVCCILVLTLINCWDVKWATAV 195
            ...:.::..|   :.:.:..:..:..        ..|....|||:...:::|:|....||.:...
Human   149 AGASALSSMFDSLANHTISRWMADSVGTLNGLGKGEESYPDLLALLIAVIVTIIVALGVKNSIGF 213

  Fly   196 QDIFTYAKLLA-LFIIIATGVYQLYLGNTQYFTFENTDTKVTSIALSFYSGLFAYNGWN------ 253
            .::.....|.. :||:||    .|:..|.:|:.                .|.|..:||:      
Human   214 NNVLNVLNLAVWVFIMIA----GLFFINGKYWA----------------EGQFLPHGWSGVLQGA 258

  Fly   254 ------YLNFII-----EELKDPVKNLPRAIAISCTLVTIVYVMAN------VSFYTILSPDEVM 301
                  ::.|.|     ||.|:|..::|.||..|..:....||..:      |.:|||.:...:|
Human   259 ATCFYAFIGFDIIATTGEEAKNPNTSIPYAITASLVICLTAYVSVSVILTLMVPYYTIDTESPLM 323

  Fly   302 GSSAVAVTYAER---AFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQI 363
            ........||.:   |.|.:|.     :.:|..|:    |....|:.||.|.:|.:...|.  .:
Human   324 EMFVAHGFYAAKFVVAIGSVAG-----LTVSLLGS----LFPMPRVIYAMAGDGLLFRFLA--HV 377

  Fly   364 QRFTPTPAVLAMA---LLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQP 418
            ..:|.||.|..:.   |.::|.|.|| :..||..:...|.|:..:..:|:..||: ||
Human   378 SSYTETPVVACIVSGFLAALLALLVS-LRDLIEMMSIGTLLAYTLVSVCVLLLRY-QP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1607NP_001263139.1 2A0308 42..501 CDD:273332 97/422 (23%)
SLC7A14NP_066000.2 2A0303 48..677 CDD:273330 97/434 (22%)
AA_permease_C 627..677 CDD:290617
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 736..771
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2200
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.