DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1607 and Slc7a14

DIOPT Version :9

Sequence 1:NP_001263139.1 Gene:CG1607 / 43707 FlyBaseID:FBgn0039844 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001128087.1 Gene:Slc7a14 / 499587 RGDID:1594375 Length:412 Species:Rattus norvegicus


Alignment Length:132 Identity:30/132 - (22%)
Similarity:49/132 - (37%) Gaps:32/132 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 CTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTS 341
            |.|:..:.:....|| .|...:.:.|.|..|:...  ...:|..|:.|||.|             
  Rat   209 CVLLLFILMFIFCSF-VIFGSEYISGQSWWAILLV--VLMLLLITVLVFVIL------------- 257

  Fly   342 SRLFYAGANNGQMPEILTMIQIQRFTP-TPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGV 405
                       |.||  ...::....| .|.|.|.|:|..:||.:.  .:.|.::.||.|..:|:
  Rat   258 -----------QQPE--NPKKLPYMAPCLPFVPAFAMLVNIYLMLK--LSTITWIRFAVWCFVGM 307

  Fly   406 AV 407
            .:
  Rat   308 LI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1607NP_001263139.1 2A0308 42..501 CDD:273332 30/132 (23%)
Slc7a14NP_001128087.1 AA_permease_C 268..318 CDD:290617 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.