DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1607 and CG12531

DIOPT Version :9

Sequence 1:NP_001263139.1 Gene:CG1607 / 43707 FlyBaseID:FBgn0039844 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_608350.2 Gene:CG12531 / 32986 FlyBaseID:FBgn0031064 Length:812 Species:Drosophila melanogaster


Alignment Length:421 Identity:99/421 - (23%)
Similarity:173/421 - (41%) Gaps:89/421 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VGSIIGSGIF---------VSPTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMIT-KSG 113
            :||..|:|::         ::..||:       ::.|:..|:.:||  || ||||.|..:. .||
  Fly    67 IGSCCGTGMYLVAGMVAQKIAGPGVI-------ISFIIAAIASIFS--GA-CYAEFGVRVPHTSG 121

  Fly   114 ADYAYIMETFGPFMAFIRLW---IECMI-VRPCSQAI-----------VALTFSTYVLKPFFPEC 163
            :.|.|.....|.|:|||..|   :|.:| ...|:.|:           :|.|.|..:...|   .
  Fly   122 SAYMYSYVAVGEFVAFIIGWNMILEYLIGTSACACALSSSFDSLTGNAIARTISESIGTIF---G 183

  Fly   164 TPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFTF 228
            .||:    .:|....|::|.:.......:...........|.....::|.|::.:          
  Fly   184 KPPD----FIAFGITLLMTCVLAMGASKSVIFNHSLNAVNLATWVFVMAAGLFYV---------- 234

  Fly   229 ENTDTKVTSIALSF----YSGLF--------AYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVT 281
               |||..|....|    :||:|        |:.|::.:....||..:|.|::|:||..|..:|.
  Fly   235 ---DTKTWSEHQGFLPYGWSGVFSGAATCFYAFIGFDIIATTGEEAHNPQKSIPKAIVGSLVVVL 296

  Fly   282 IVYVMANVSFYTILSPDEVMGSSAVAV---TYAE----RAFGMLAWTIPVFVALSTFGAVNGILL 339
            |.||..:: ..|::.|.:.:.:.|..|   :|..    ||...:..|..:.||:  ||:    :.
  Fly   297 IAYVSVSL-VLTLVVPYDHINTGAALVQMWSYVNAPKCRAVVAIGATAGLSVAM--FGS----MF 354

  Fly   340 TSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIG 404
            ...|:.||.|.:|.:...|:.:..:...|..|.:...|.:.|......:..|:..:...|.|:..
  Fly   355 PMPRVIYAMAQDGLIFRQLSQLWHRTNVPGLATIGSGLAAALVALTVRLEILVEMMSIGTLLAYT 419

  Fly   405 VAVLCLPWLRWAQPN-------LPRPIRVPM 428
            :...|:..||: ||:       ||..:|.|:
  Fly   420 LVSTCVLVLRY-QPHSTSLVELLPAQLRTPV 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1607NP_001263139.1 2A0308 42..501 CDD:273332 99/421 (24%)
CG12531NP_608350.2 2A0303 52..679 CDD:273330 99/421 (24%)
AA_permease_C 629..679 CDD:290617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2200
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.