DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1607 and Slc7a14

DIOPT Version :9

Sequence 1:NP_001263139.1 Gene:CG1607 / 43707 FlyBaseID:FBgn0039844 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_766449.1 Gene:Slc7a14 / 241919 MGIID:3040688 Length:771 Species:Mus musculus


Alignment Length:460 Identity:104/460 - (22%)
Similarity:189/460 - (41%) Gaps:117/460 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SIVNGNGDASAKLTNGDGDGGGDGGGEVTLKAKMSLLNGCTVIVGSIIGSGIFVSPTGVLMYTGS 80
            |::.|.|..||..|.              |...::.::..::.|||.:|:|::| .:|::....:
Mouse    34 SMLEGTGTTSAHGTK--------------LAQVLTTVDLISLGVGSCVGTGMYV-VSGLVAKEMA 83

  Fly    81 VNLALIVWVISGLFSMVGAYCYAELGTMITK-SGADYAYIMETFGPFMAFIRLW---IECMIVRP 141
            ....::.::|:.:.|::...||||.|..:.| :|:.|.|...|.|.|:||...|   :|.:|...
Mouse    84 GPGVIVSFIIAAVASILSGVCYAEFGVRVPKTTGSAYTYSYVTVGEFVAFFIGWNLILEYLIGTA 148

  Fly   142 CSQAIVALTF--------STYVL------------KPFFPECTPPEDSARLLAVCCILVLTLINC 186
            ...:.::..|        |.:::            :..:|:         |||:...:::|:|..
Mouse   149 AGASALSSMFDSLANHSISRWMVDTVGTLNGLGKGEESYPD---------LLALVIAVIVTIIVA 204

  Fly   187 WDVKWATAVQDIFTYAKLLA-LFIIIATGVYQLYLGNTQYFTFENTDTKVTSIALSFYSGLFAYN 250
            ..||.:....::.....|.. :||:||    .|:..|.:|:.                .|.|..:
Mouse   205 LGVKNSVGFNNVLNVLNLAVWVFIMIA----GLFFINGKYWA----------------EGQFLPH 249

  Fly   251 GWN------------YLNFII-----EELKDPVKNLPRAIAISCTLVTIVYVMAN------VSFY 292
            ||:            ::.|.|     ||.|:|..::|.||..|..:....||..:      |.:|
Mouse   250 GWSGVLQGAATCFYAFIGFDIIATTGEEAKNPNTSIPYAITASLVICLTAYVSVSMILTLMVPYY 314

  Fly   293 TILSPDEVMGSSAVAVTYAER---AFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQM 354
            .|.:...:|........||.:   |.|.:|.     :.:|..|:    |....|:.||.|.:|.:
Mouse   315 AIDTESPLMEMFVAHGFYAAKFVVAIGSVAG-----LTVSLLGS----LFPMPRVIYAMAGDGLL 370

  Fly   355 PEILTMIQIQRFTPTPAVLAM------ALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWL 413
            ...|.  .:..:|.||.|..:      ||||:| :::.|   ||..:...|.|:..:..:|:..|
Mouse   371 FRFLA--HVSSYTETPVVACIVSGFLAALLSLL-VSLRD---LIEMMSIGTLLAYTLVSVCVLLL 429

  Fly   414 RWAQP 418
            |: ||
Mouse   430 RY-QP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1607NP_001263139.1 2A0308 42..501 CDD:273332 98/434 (23%)
Slc7a14NP_766449.1 2A0303 43..677 CDD:273330 101/451 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 735..771
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53617
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2200
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.