DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-2 and Gabrp

DIOPT Version :9

Sequence 1:NP_001303470.1 Gene:pHCl-2 / 43703 FlyBaseID:FBgn0039840 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_112291.1 Gene:Gabrp / 81658 RGDID:620532 Length:440 Species:Rattus norvegicus


Alignment Length:519 Identity:134/519 - (25%)
Similarity:224/519 - (43%) Gaps:109/519 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AGVHLGDLQQNLAANGSVVVSPLNTTDAFSVSINLSQSTVNNCPSLKNAESMALMELLTRLTAPC 83
            |.|.|..|.|.:...|:            ..::.:|:|...:.|..:|            |||  
  Rat     8 AFVCLNLLAQRMCIQGN------------QFNVEVSRSDKLSLPGFEN------------LTA-- 46

  Fly    84 RYDRMVPPVVHNKDGEEVPMDIYARFYIYVMKNLDSSDLQFTVQGLLQLRYLDPRLAFSSYLPNR 148
            .|::.:.|   |..|:  |:.|.....|..:.::..|::.:|....|:.|:.||||.|..   |:
  Rat    47 GYNKFLRP---NFGGD--PVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEG---NK 103

  Fly   149 RQPIMGESELKKMLWVPHIFLTNEQASTVLGTSAKDELTSIYPNGTVLTSTRLQATLYCWMNFQK 213
            ...:  ::.|.:.||||..::...:.|.:...:..:.|..::.|||||.:.|:..|:.|.|:..|
  Rat   104 SFTL--DARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMDLSK 166

  Fly   214 FPFDEQKCKTTLESWMYNTTLVQLHWETDN-PVSFDKQLQLTEYNLIGSLYNESIRVSNESYMSH 277
            :|.|.|.||..||||.|:...|:..|...| .|...:.|:|.:|.:  ..|...:.||.:.    
  Rat   167 YPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQYTI--QQYFTLVTVSQQE---- 225

  Fly   278 GSLEGNYSIISFTVLLTREVGYYVIDYFLPSIMIVTISWVSFWLQADQTPARTTLGCTTLLSFIT 342
               .|||:.:.....|.|.|.|::::.::||..:|.:||||||:..:..||||.:|.||:||..|
  Rat   226 ---TGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLESVPARTCIGVTTVLSMTT 287

  Fly   343 LSLSQENNLMKVS-YVTMSEVWFLVCTIFIFGSLVEFAFVNTIWRRNNDLQLKKRTTKYIVKSTF 406
            |.:....:|...: ::...:|:..:|..|:||:|:|:|                           
  Rat   288 LMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYA--------------------------- 325

  Fly   407 VPHLKKHRRHGYRRTDSTMSTMSTTSMDKTCGPNNTVITIETPIIIGGSLS---REDSAISLDEQ 468
            |.|.            |::..|:.    |..||......:....||..|:|   |:.|..|::..
  Rat   326 VAHY------------SSLQQMAV----KDRGPAKDSEEVNITNIINSSISSFKRKISFASIEIS 374

  Fly   469 DET-----STSESSDSSK----EKPAQT---FATMTPKEVSLWIDRKMRFVFPLSFIVFNALFW 520
            .:.     .|.::||..|    ||..:.   |....|..|    ||..:.:|||.|::.|..:|
  Rat   375 GDNVNYSDLTMKASDKFKFVFREKIGRIIDYFTIQNPSNV----DRYSKLLFPLIFMLANVFYW 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-2NP_001303470.1 LIC 46..522 CDD:273305 128/492 (26%)
GabrpNP_112291.1 LIC 43..437 CDD:273305 125/472 (26%)
LGIC_ECD 60..241 CDD:355788 54/194 (28%)
Cys-loop 159..174 CDD:349787 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.