DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-2 and lgc-38

DIOPT Version :10

Sequence 1:NP_651861.1 Gene:pHCl-2 / 43703 FlyBaseID:FBgn0039840 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001355511.1 Gene:lgc-38 / 3565717 WormBaseID:WBGene00017389 Length:479 Species:Caenorhabditis elegans


Alignment Length:61 Identity:16/61 - (26%)
Similarity:27/61 - (44%) Gaps:15/61 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DTIRTVGGELVEQVK-LTDEFENKKKEKKSQ-------------TYRIVYRSHERALTKEE 53
            |....||| .::.|| |..:.::.:.:|:||             :.|.:..:..||..|||
 Worm   154 DQASIVGG-AIDFVKILEQQLQSLEAQKRSQQSDDNKEQIPEDNSLRNISSNKLRASNKEE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-2NP_651861.1 LIC 46..522 CDD:455710 5/8 (63%)
lgc-38NP_001355511.1 LIC 42..476 CDD:455710 16/61 (26%)
LGIC_ECD_GABAR_RDL-like 76..257 CDD:349809 16/61 (26%)
Cys-loop 177..191 CDD:349809 3/13 (23%)

Return to query results.
Submit another query.