DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-2 and Gabra2

DIOPT Version :9

Sequence 1:NP_001303470.1 Gene:pHCl-2 / 43703 FlyBaseID:FBgn0039840 Length:526 Species:Drosophila melanogaster
Sequence 2:XP_017454595.1 Gene:Gabra2 / 289606 RGDID:61856 Length:504 Species:Rattus norvegicus


Alignment Length:456 Identity:126/456 - (27%)
Similarity:205/456 - (44%) Gaps:91/456 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YDRMVPPVVHNKDGEEVPMDIYARFYIYVMKNLDSSDLQFTVQGLLQLRYLDPRLAFSSYLPNRR 149
            ||..:.|.:    |:.: .:::...|:.....:..:|:::|:....:.::.|.||.|...:...|
  Rat   106 YDNRLRPGL----GDSI-TEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILR 165

  Fly   150 QPIMGESELKKMLWVPHIFLTNEQASTVLGTSAKDELTSIYPNGTVLTSTRLQATLYCWMNFQKF 214
            .    .:.:...:|.|..|..|.:.|.....:..::|..|..:||:|.:.||.....|.|:.:.|
  Rat   166 L----NNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDF 226

  Fly   215 PFDEQKCKTTLESWMYNTTLVQLHW---ETDNPVSFDKQLQLTEYNLIG-SLYNESIRVSNESYM 275
            |.|...|.....|:.|.|:.|...|   .:|:........:|.:|:|:| |:..|:|:.|.    
  Rat   227 PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSST---- 287

  Fly   276 SHGSLEGNYSIISFTVLLTREVGYYVIDYFLPSIMIVTISWVSFWLQADQTPARTTLGCTTLLSF 340
                  |.|::::....|.|::||:||..:||.||.|.:|.|||||..:..||||..|.||:|:.
  Rat   288 ------GEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM 346

  Fly   341 ITLSLSQENNLMKVSYVTMSEVWFL-VCTIFIFGSLVEFAFVNTIWRRN---------NDLQLKK 395
            .|||:|..|:|.||:|.|..: ||: ||..|:|.:|:|||.||...:|.         ||.:.:|
  Rat   347 TTLSISARNSLPKVAYATAMD-WFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEK 410

  Fly   396 -----RTTKYIVK-STFVPHLKKHRRHGYRRTDSTMSTMSTTSMDKTCGPNNTVITIETPIIIGG 454
                 :...|.|. :.:.|:|.|         |..:||:|.::                      
  Rat   411 GSVMIQNNAYAVAVANYAPNLSK---------DPVLSTISKSA---------------------- 444

  Fly   455 SLSREDSAISLDEQDETSTSESSDSSKEKPAQTFATMTPKEVSLWIDRKMRFVFPLSFIVFNALF 519
                             :|.|.:...:.|||:  |..|...||. |||..|.|||:.|..||.::
  Rat   445 -----------------TTPEPNKKPENKPAE--AKKTFNSVSK-IDRMSRIVFPVLFGTFNLVY 489

  Fly   520 W 520
            |
  Rat   490 W 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-2NP_001303470.1 LIC 46..522 CDD:273305 126/456 (28%)
Gabra2XP_017454595.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.