DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-2 and GABRA2

DIOPT Version :9

Sequence 1:NP_001303470.1 Gene:pHCl-2 / 43703 FlyBaseID:FBgn0039840 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001317619.1 Gene:GABRA2 / 2555 HGNCID:4076 Length:511 Species:Homo sapiens


Alignment Length:475 Identity:133/475 - (28%)
Similarity:216/475 - (45%) Gaps:69/475 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YDRMVPPVVHNKDGEEVPMDIYARFYIYVMKNLDSSDLQFTVQGLLQLRYLDPRLAFSSYLPNRR 149
            ||..:.|.:    |:.: .:::...|:.....:..:|:::|:....:.::.|.||.|...:...|
Human    53 YDNRLRPGL----GDSI-TEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILR 112

  Fly   150 QPIMGESELKKMLWVPHIFLTNEQASTVLGTSAKDELTSIYPNGTVLTSTRLQATLYCWMNFQKF 214
            .    .:.:...:|.|..|..|.:.|.....:..::|..|..:||:|.:.||.....|.|:.:.|
Human   113 L----NNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDF 173

  Fly   215 PFDEQKCKTTLESWMYNTTLVQLHW---ETDNPVSFDKQLQLTEYNLIG-SLYNESIRVSNESYM 275
            |.|...|.....|:.|.|:.|...|   .:|:........:|.:|:|:| |:..|:|:.|.    
Human   174 PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSST---- 234

  Fly   276 SHGSLEGNYSIISFTVLLTREVGYYVIDYFLPSIMIVTISWVSFWLQADQTPARTTLGCTTLLSF 340
                  |.|::::....|.|::||:||..:||.||.|.:|.|||||..:..||||..|.||:|:.
Human   235 ------GEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM 293

  Fly   341 ITLSLSQENNLMKVSYVTMSEVWFL-VCTIFIFGSLVEFAFVNTIWRRN---------ND----- 390
            .|||:|..|:|.||:|.|..: ||: ||..|:|.:|:|||.||...:|.         ||     
Human   294 TTLSISARNSLPKVAYATAMD-WFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKSPSI 357

  Fly   391 ----LQLKKRTTKYIVK------STFV----PHLKKHRRHGYRRTDSTMSTMSTTSMDKTCG--- 438
                :.|...:.|.|::      |.::    |.|.:.:...|........|...:|..:...   
Human   358 KAEGITLTYNSVKAILQGAKLIWSKYIAFSWPSLFQEKTLEYLEKWMDCLTFKQSSKKEKASVMI 422

  Fly   439 PNN---TVITIETPIIIGGSLSREDSAISLDEQDETSTSESSDSSKEKPAQTFATMTPKEVSLWI 500
            .||   ..:....|     :||: |..:|...:..| |.|.:...:.|||:  |..|...||. |
Human   423 QNNAYAVAVANYAP-----NLSK-DPVLSTISKSAT-TPEPNKKPENKPAE--AKKTFNSVSK-I 477

  Fly   501 DRKMRFVFPLSFIVFNALFW 520
            ||..|.|||:.|..||.::|
Human   478 DRMSRIVFPVLFGTFNLVYW 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-2NP_001303470.1 LIC 46..522 CDD:273305 133/475 (28%)
GABRA2NP_001317619.1 LIC 25..500 CDD:273305 133/475 (28%)
LGIC_ECD_GABAAR_A2 47..249 CDD:349836 47/214 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.