DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pHCl-2 and Glra3

DIOPT Version :9

Sequence 1:NP_001303470.1 Gene:pHCl-2 / 43703 FlyBaseID:FBgn0039840 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_446176.3 Gene:Glra3 / 114516 RGDID:621229 Length:480 Species:Rattus norvegicus


Alignment Length:491 Identity:139/491 - (28%)
Similarity:225/491 - (45%) Gaps:70/491 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VVSPLNTTDAFSVSINLSQSTVNNCPSLKNAESMALMELLTRLTAPCRYDRMVPPVVHNKDGEEV 101
            :|:...|..|.|.|..:|.|..             |.:|:.|.:.   ||..:.|   |..|.  
  Rat    41 LVATKETNSARSRSAPMSPSDF-------------LDKLMGRTSG---YDARIRP---NFKGP-- 84

  Fly   102 PMDIYARFYIYVMKNLDSSDLQFTVQGLLQLRYLDPRLAFSSYLPNRR---QPIMGESELKKMLW 163
            |:::....:|....::..:.:.:.|...|:.::.|||||:|.| |:..   .|.|.:|     :|
  Rat    85 PVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEY-PDDSLDLDPSMLDS-----IW 143

  Fly   164 VPHIFLTNEQASTVLGTSAKDELTSIYPNGTVLTSTRLQATLYCWMNFQKFPFDEQKCKTTLESW 228
            .|.:|..||:.:.....:..::|..|:.||.||.|.||..||.|.|:.:.||.|.|.|...|||:
  Rat   144 KPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESF 208

  Fly   229 MYNTTLVQLHWETDNPVSFDKQLQLTEYNLIGSLYNESIRVSNESYMSHGSLEGNYSIISFTVLL 293
            .|....:...|:.:.||...:.|.|.::.|   ...:.:|...:.|.:     |.::.|.....|
  Rat   209 GYTMNDLIFEWQDEAPVQVAEGLTLPQFLL---KEEKDLRYCTKHYNT-----GKFTCIEVRFHL 265

  Fly   294 TREVGYYVIDYFLPSIMIVTISWVSFWLQADQTPARTTLGCTTLLSFITLSLSQENNLMKVSYVT 358
            .|::|||:|..::||::||.:||||||:..|..|||..||.||:|:..|.|.....:|.|||||.
  Rat   266 ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVK 330

  Fly   359 MSEVWFLVCTIFIFGSLVEFAFVNTIWRRNNDLQLKKRTTKYIVKSTFVPHLKKHRRHGYRRTDS 423
            ..::|..||.:|:|.:|:|:|.||.:.|::.:|...:|..|   ..|....|:|..|  :..||.
  Rat   331 AIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRK---NKTEAFALEKFYR--FSDTDD 390

  Fly   424 TM--STMSTTSMDKTCGPNNTVITIETPIIIGGSLSREDSAISLDEQDETSTSESSDSSKEKPAQ 486
            .:  |..|.|:..                 :|..|..:|..:   .:......:....|.::..:
  Rat   391 EVRESRFSFTAYG-----------------MGPCLQAKDGVV---PKGPNHAVQVMPKSADEMRK 435

  Fly   487 TFATMTPKEVSLWIDRKMRFVFPLSFIVFNALFWTL 522
            .|.....|     ||...|..|||:|::||..:|.:
  Rat   436 VFIDRAKK-----IDTISRACFPLAFLIFNIFYWVI 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pHCl-2NP_001303470.1 LIC 46..522 CDD:273305 137/480 (29%)
Glra3NP_446176.3 LIC 28..467 CDD:273305 139/491 (28%)
Neur_chan_LBD 63..269 CDD:280998 62/227 (27%)
Neur_chan_memb 276..464 CDD:280999 65/217 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.