DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk24 and ppk29

DIOPT Version :9

Sequence 1:NP_651860.2 Gene:ppk24 / 43702 FlyBaseID:FBgn0039839 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster


Alignment Length:521 Identity:109/521 - (20%)
Similarity:176/521 - (33%) Gaps:171/521 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FVFHITALTVLIAFLWGTYTKEQEALVTTMYH---------PMYPIWKVEFPAISVCSLNRISQR 145
            ||.:...|.:.:..:.|..|.....|:.|.|.         ..|..|...||:|.:|        
  Fly    16 FVENKGLLWIFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAYSRWINTFPSIGIC-------- 72

  Fly   146 AAWQYAHNLSGKDPKQRNASHFYDQLKAFMYMYYDPSDLMDIDNALRFQSFLDRFDTAKEELFFN 210
                            ...|..:::.||.|..|:...........:...:||:..:...:|...|
  Fly    73 ----------------LTKSRAFNEFKAMMREYFQEDFAFSFTRMIYEYAFLNPNNIFTKEPTKN 121

  Fly   211 T-----------RNRMSALTPNCSDMFVSCRIAGRLF-DCMDKFETTLTSHGFCCTFN----YDG 259
            |           |.:|  ...||::.|......|.|. ||.:.|:..:|..|:|...|    ||.
  Fly   122 TSYPYNFNILDIRRKM--FPTNCTECFKEIYFRGELVTDCEEIFKFHVTEMGYCFLANNLLDYDS 184

  Fly   260 ------RYV---NKRDFR-----------QRYF-GPD-----MGLVLTLKTDPSD---NFYKING 295
                  ||.   |.|..|           :.|. .|:     ..|..|:.|||:.   |..:|:.
  Fly   185 IEEMPLRYSSLDNNRSLRLYMRSSVMYKYEMYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHN 249

  Fly   296 HNGYPDPFSGGVAERVAETGFNTLLPVRAKIFETLPEARSMSPSVRKCLFENEMPWIFARHYTFS 360
            |.|..|.                  |:                |.|||.|.:|.. |....|:||
  Fly   250 HEGVIDE------------------PI----------------SQRKCKFPSESS-IEGFPYSFS 279

  Fly   361 KCISACRAQSVVSLCECVPFSLPHRYIDGSEKRIYCTLQHLACLKRYEFKWLNVITSRENVTGLE 425
            .|:|..|::..:..|:|..|:...|     .:.:||.|||..||.:..|     .|..:...|..
  Fly   280 ACMSIIRSEFEMKTCDCSLFNPKDR-----NESLYCGLQHADCLIKEGF-----ATRVKEYVGSS 334

  Fly   426 HELQDALYCPLCLASCTETRYSVRGAMTLGLPTPSQIKGPARSNPGPRANNSYGPASSSGSAKGP 490
                     .:||.||.|.:.|:.|.:|               ..|...||:             
  Fly   335 ---------TVCLPSCVEQQISLVGVIT---------------ENGTLYNNN------------- 362

  Fly   491 VHSSSAPAELAVVRIYFAETHIQYFRQIIKSAWYETFSTIGNICGIIAGFSLIGICELLFFLAKQ 555
                   .::..::|....| ::|.|::.::. .:....||::.|:..|.||:.:.|::.:..|:
  Fly   363 -------TQITEIQIASPPT-VRYERKVTQTK-LDLIVGIGSVAGLFFGASLLNLLEIISYFIKK 418

  Fly   556 L 556
            |
  Fly   419 L 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk24NP_651860.2 ASC 65..551 CDD:279230 107/514 (21%)
ppk29NP_001097442.2 ASC 123..415 CDD:279230 83/384 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456693
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.