DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk24 and F58G6.8

DIOPT Version :9

Sequence 1:NP_651860.2 Gene:ppk24 / 43702 FlyBaseID:FBgn0039839 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001023246.2 Gene:F58G6.8 / 3565898 WormBaseID:WBGene00010278 Length:162 Species:Caenorhabditis elegans


Alignment Length:97 Identity:19/97 - (19%)
Similarity:38/97 - (39%) Gaps:17/97 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DTRKLSFAAALKDLLQNLSFHCYSKLVESGRRIQERFFWFVFHITALTVLIAFLWGTYTKEQEAL 115
            |||.:.|...||:..:..:.|....:.::...|.    ..|:.|..:...:||::..|:      
 Worm    47 DTRWIQFKNHLKNWGETATIHGVPHMAQAHTVIA----IIVWSIILIVSAVAFVYMFYS------ 101

  Fly   116 VTTMYHPMYPIWKVE-------FPAISVCSLN 140
            :...|.....:..:.       ||:|:.|:.|
 Worm   102 IAASYLAFNVVVNLNTGLDSEPFPSITFCNTN 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk24NP_651860.2 ASC 65..551 CDD:279230 13/83 (16%)
F58G6.8NP_001023246.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.