DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk24 and egas-3

DIOPT Version :9

Sequence 1:NP_651860.2 Gene:ppk24 / 43702 FlyBaseID:FBgn0039839 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:326 Identity:68/326 - (20%)
Similarity:110/326 - (33%) Gaps:71/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GFCCTFNYDGR---YVNKRDFRQRYFGPDMGLVLTLKT--DPSDNFY---KING--HNGYPDPFS 304
            |.|.|||:..|   |:.:|.      |...|:...:||  |....:|   .||.  ||.....||
 Worm   649 GNCFTFNHRDRNFTYLMRRP------GRHGGIQAFMKTRQDEYAPWYDTAAINVFIHNRDDYVFS 707

  Fly   305 GGVAERVAETGFNTLLPVRAKIFETLPEARSMSPSVRKCLFE-NEMP-WIFARHYTFSKCISACR 367
            ..|.........:|:     .||.|  ....:..:..||:.: :|:. :.:...||...|:..|.
 Worm   708 ESVRYNAQPNAQSTI-----NIFMT--RYTRLGGNYGKCIKKPSEVKNYYYPGAYTTDGCLRTCY 765

  Fly   368 AQSVVSLCECVPFSLPHRYIDGSEKRIYCTLQHLACLKRYEFKWLNVITSRENVTGLEHELQDAL 432
            ...:...|.|:....|.     :.....|.|...:|           :|......| :.....:.
 Worm   766 QDRMKEECNCMDPRYPQ-----APNSTSCQLSERSC-----------VTEASEAAG-DPSTWSSC 813

  Fly   433 YCPLCLASCTETRYSV--RGAMTLGLPTPSQIKGPARSNPGPRANNSYGPASSSGSAKGPVHSSS 495
            .|||   .|:...|||  ..|..:.||...:              .|...|:.....|..:..|.
 Worm   814 VCPL---PCSNQEYSVTWSKANFVNLPITCE--------------KSSDVATCQKQYKDQLMVSI 861

  Fly   496 APAELAVVRIYFAETHIQYFRQIIKSAWYETFSTIGNICGIIAGFSLIGICELLFFLAKQLWQAC 560
            ...:|. .:|| |||....|.:.:        |.:|...|::.|.:::...|::|.........|
 Worm   862 ILPQLD-FKIY-AETPAMDFNKFL--------SQLGGQLGVLMGINVVTFIEVVFLFFGMFMVLC 916

  Fly   561 R 561
            :
 Worm   917 Q 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk24NP_651860.2 ASC 65..551 CDD:279230 66/314 (21%)
egas-3NP_507638.2 ASC <649..907 CDD:279230 66/314 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.