DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk24 and del-10

DIOPT Version :9

Sequence 1:NP_651860.2 Gene:ppk24 / 43702 FlyBaseID:FBgn0039839 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_495302.3 Gene:del-10 / 174069 WormBaseID:WBGene00020897 Length:1069 Species:Caenorhabditis elegans


Alignment Length:362 Identity:66/362 - (18%)
Similarity:115/362 - (31%) Gaps:97/362 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VESGRRIQERF----FWFVFHITALTVLIAFLW-------------------GTYTKEQEALVTT 118
            |||.::..:.|    ...|.|:.|.:.:...||                   ..|..|.   |.|
 Worm    65 VESDKQFLDAFKDANMDAVHHLNAASPVTRGLWCMIIIAFVILVLVQCYSQIKLYISEP---VAT 126

  Fly   119 MYHPMYPIWKVEFPAISVCSLNRISQRAAWQYAHNLSGKDPKQRNASHFYDQLKAFMYMYYDPSD 183
            .....||. |:.||.:::|:.|:.  |..:.....:..:..|..:.|        .:...:|...
 Worm   127 NIEAEYPS-KISFPTVAICNNNQF--RLTYLTGGRIMNRRSKSISGS--------LLSTGHDVES 180

  Fly   184 LMDIDNALRFQSFLDRFDTAKEELFFNTRNRMSALTPNCSDMFVSCRIAGRLFDCMDKFETTLTS 248
            :  .|..||....:|.....:....:.:|..:....||.:    ||:::        .|:...|:
 Worm   181 V--FDTVLRKSWDMDAVKFLRSAAHWKSRMILGCTWPNGT----SCKLS--------DFKAVWTT 231

  Fly   249 HGFCCTFNYDGRYVNKRDFRQRYFGPDMGLVLTL------KTDPSDNFYK----------INGHN 297
            .|.|...|.|..    ..:.....|...||.|.|      :.|.....::          |....
 Worm   232 TGLCWAINTDPH----NPYEVTGSGEGHGLRLLLNVESYERVDACTKHFRTKTLPGLKILIYNQT 292

  Fly   298 GYPDPFSGGVAERVAETGFNTLLPVRAKIFETLPEARSMSPSVRKCLFENEMPWIFARHYTFSKC 362
            ..||....||.   ..:|::..:|.:.       :.||....|. |:.||:.....:..:...:.
 Worm   293 DIPDSSMNGVN---VPSGYSMDIPFKM-------QHRSKLTGVH-CIEENDEQIEASTDFNNPEN 346

  Fly   363 ISACRAQSVVSLCECVPFSLPHRYIDGSEKRIYCTLQ 399
            |..|..:               ||:...|...:|||:
 Worm   347 IRTCTLR---------------RYMTEVENSCHCTLR 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk24NP_651860.2 ASC 65..551 CDD:279230 66/362 (18%)
del-10NP_495302.3 ASC 83..>419 CDD:279230 62/344 (18%)
ASC <789..849 CDD:279230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.