DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH6 and Car7

DIOPT Version :10

Sequence 1:NP_001097987.1 Gene:CAH6 / 43701 FlyBaseID:FBgn0039838 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_444300.1 Gene:Car7 / 12354 MGIID:103100 Length:264 Species:Mus musculus


Alignment Length:126 Identity:30/126 - (23%)
Similarity:39/126 - (30%) Gaps:41/126 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 PYTFPGGSGNV------FQKNTRRAAEVWMDEYKAIYLKNVPSARFVNFGDITDRLAIRDR-LQC 438
            ||.||...|..      ..|......:.|....||:|               .|..|.|:: |:.
Mouse    75 PYCFPDQPGGTSYERYETYKVPNWCLDHWHPSEKAMY---------------PDYFAKREQWLKL 124

  Fly   439 KSFKWYLENVYPQLEIPRKTPGKSFQMKIGNLCLDSMARKESEAPGLFGCHGTGGNQEWVF 499
            ::..|..|....|.|.|...|      |...|   ..||||.:.|.|:          |.|
Mouse   125 RAQSWEKEVQQLQSETPADGP------KTEAL---PPARKEGDLPPLW----------WQF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH6NP_001097987.1 Carb_anhydrase 26..287 CDD:459707
Car7NP_444300.1 alpha_CA_VII 27..262 CDD:239402 30/126 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.