DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and ERG20

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_012368.1 Gene:ERG20 / 853272 SGDID:S000003703 Length:352 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:56/244 - (22%)
Similarity:106/244 - (43%) Gaps:48/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LLKSGTSQPELDTIA-SYYFDGQGKALRPMVTMLMAKAINYHLNNES-HQLVHKQ-RQIALFS-- 190
            ||..|..:...|..| |..::..|..|...::::...||   |:|:: .||..:: .::|:..  
Yeast    27 LLAYGMPKEACDWYAHSLNYNTPGGKLNRGLSVVDTYAI---LSNKTVEQLGQEEYEKVAILGWC 88

  Fly   191 -EMVHSASLVHDDVIDQSDFRRGKPSVNALWNHKKVTMAGDYIL--------SIASIMIARLRSD 246
             |::.:..||.||::|:|..|||:|    .|  .||...|:..:        :|..::.:..|::
Yeast    89 IELLQAYFLVADDMMDKSITRRGQP----CW--YKVPEVGEIAINDAFMLEAAIYKLLKSHFRNE 147

  Fly   247 ----DVTIVLSQILTDLVQGEFMQLGSRETENERFAHYLTKTYR-----KTASL-----IANALK 297
                |:|.:..::......|:.|.|.:...:....:.:..|.:.     |||..     :|.|:.
Yeast   148 KYYIDITELFHEVTFQTELGQLMDLITAPEDKVDLSKFSLKKHSFIVTFKTAYYSFYLPVALAMY 212

  Fly   298 ATAVIAQADDNVAEVAFQYGRNI----GLAFQLVDDMLDFVSSTEQMGK 342
            ...:..:.|       .:..|::    |..||:.||.||...:.||:||
Yeast   213 VAGITDEKD-------LKQARDVLIPLGEYFQIQDDYLDCFGTPEQIGK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 56/244 (23%)
ERG20NP_012368.1 polyprenyl_synt 38..305 CDD:395277 53/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.