DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and SPS2

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_173148.2 Gene:SPS2 / 838275 AraportID:AT1G17050 Length:417 Species:Arabidopsis thaliana


Alignment Length:348 Identity:123/348 - (35%)
Similarity:201/348 - (57%) Gaps:16/348 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QSSKANLRQHSSVHTQQPAGPVREFQIDPYIILDDDLKYFYDDVRYLLKSGTSQPELDTIASYYF 149
            |:...||||.|    ::|......|:     ::.|||:...|::..::  |...|.|.:.|...|
plant    79 QTVMLNLRQES----RKPISLETLFE-----VVADDLQRLNDNLLSIV--GAENPVLISAAEQIF 132

  Fly   150 DGQGKALRPMVTMLMAKAINYHLNNESHQLVHKQRQIALFSEMVHSASLVHDDVIDQSDFRRGKP 214
            ...||.:||.:..|:::|.......:  :|..:.|::....||:|:|||:||||:|:||.|||:.
plant   133 SAGGKRMRPGLVFLVSRATAELAGLK--ELTVEHRRLGEIIEMIHTASLIHDDVLDESDMRRGRE 195

  Fly   215 SVNALWNHKKVTMAGDYILSIASIMIARLRSDDVTIVLSQILTDLVQGEFMQLGSRETENERFAH 279
            :|:.|:..:...:|||::.:.||..:|.|.:.:|..::||::.|...||..|..|....:.:...
plant   196 TVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIKDFASGEIKQASSLFDCDVKLDD 260

  Fly   280 YLTKTYRKTASLIANALKATAVIAQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPT 344
            |:.|:|.|||||:|.:.|..|:.::.:..|||..:|:|:|:||:||:|||:|||..||||:|||.
plant   261 YMLKSYYKTASLVAASTKGAAIFSKVESKVAEQMYQFGKNLGLSFQVVDDILDFTQSTEQLGKPA 325

  Fly   345 AADLKLGLATAPVLFACEKYPELNPMVMRRFSEPGDVERAFELVHKSHGLEQTRFLAKKHCNEAI 409
            |.||..|..||||:||.|..|.|..::...|.|||.:|.|.|:|....|:::.:.|||:....|:
plant   326 ANDLAKGNITAPVIFALENEPRLREIIESEFCEPGSLEEAIEIVRNRGGIKKAQELAKEKAELAL 390

  Fly   410 RLAQELTESPYQKGLQVVADLVI 432
            :....|..|.::..|:   |:|:
plant   391 KNLNCLPRSGFRSALE---DMVM 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 115/316 (36%)
SPS2NP_173148.2 PLN02857 1..417 CDD:215462 123/348 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 191 1.000 Domainoid score I941
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54105
OrthoDB 1 1.010 - - D381154at2759
OrthoFinder 1 1.000 - - FOG0002103
OrthoInspector 1 1.000 - - otm3128
orthoMCL 1 0.900 - - OOG6_100316
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.