DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and GGR

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_195558.1 Gene:GGR / 830002 AraportID:AT4G38460 Length:326 Species:Arabidopsis thaliana


Alignment Length:317 Identity:65/317 - (20%)
Similarity:118/317 - (37%) Gaps:92/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LYHGLSFSMGKDYPDLLQSPH----KCSQSLQYSQSSKA-------------------NLRQHSS 96
            |:.|.:..: ..:..|.:.||    |.|.:...|.||.|                   |.:...:
plant     2 LFSGSAIPL-SSFCSLPEKPHTLPMKLSPAAIRSSSSSAPGSLNFDLRTYWTTLITEINQKLDEA 65

  Fly    97 VHTQQPAGPVREFQIDPYIILDDDLKYFYDDVRY-LLKSGTSQ--PELDTIASYYFDGQGKALRP 158
            :..:.|||                   .|:.:|| :|..|..:  |.:...|...|.|...|..|
plant    66 IPVKHPAG-------------------IYEAMRYSVLAQGAKRAPPVMCVAACELFGGDRLAAFP 111

  Fly   159 MVTMLMAKAINYHLNNESHQLVHKQRQIALFSEMVHSASLVHDDV--IDQSDFRRGKPSVNALWN 221
            ....|                           ||||:|||:|||:  :|....||||||.:.::.
plant   112 TACAL---------------------------EMVHAASLIHDDLPCMDDDPVRRGKPSNHTVYG 149

  Fly   222 HKKVTMAGDYILSIASIMIARLRSDDVT--IVLSQILTDLVQ---------GEFMQLGSRETENE 275
            .....:|||.:..:|...|......|:.  ..:.:::|::.:         |:::.|     |..
plant   150 SGMAILAGDALFPLAFQHIVSHTPPDLVPRATILRLITEIARTVGSTGMAAGQYVDL-----EGG 209

  Fly   276 RFAHYLTKTYRKTASLIANALKATAVIAQADDNVAEVAFQYGRNIGLAFQLVDDMLD 332
            .|.....:. :|..::...:.....::..|.::..:...:|||.:|:.:|:|||:.:
plant   210 PFPLSFVQE-KKFGAMGECSAVCGGLLGGATEDELQSLRRYGRAVGMLYQVVDDITE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 50/232 (22%)
GGRNP_195558.1 IspA 55..>263 CDD:223220 53/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.