DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and AT3G32040

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_189747.1 Gene:AT3G32040 / 822957 AraportID:AT3G32040 Length:360 Species:Arabidopsis thaliana


Alignment Length:343 Identity:90/343 - (26%)
Similarity:147/343 - (42%) Gaps:68/343 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KCSQSLQYSQSSKANLRQHSSVHTQQ-------PAGPVREFQIDPYIILDDDLKYFYDDVRYLLK 133
            |.:..|.::...|..:...|...|.|       |.|.            .:|..:.:|...|:::
plant    20 KYNSILSFNNLQKRTVLSLSCALTSQGGKDMIPPKGK------------SNDRNFAFDFKSYMIR 72

  Fly   134 S--------GTSQPELDTIA-----SYYFDGQGKALRPMVTMLMAKAINYHLNNESHQLVHKQRQ 185
            .        ..|.|..|.:|     .|.....||.:||::.:...:.:.   .:|:..:     .
plant    73 KAESVSMALNVSVPPQDPLAIQEAVRYSLLAGGKRVRPLLCIAACELVG---GDEATAM-----S 129

  Fly   186 IALFSEMVHSASLVHDDV--IDQSDFRRGKPSVNALWNHKKVTMAGDYILSIA--------SIMI 240
            .|...||:|::||:|||:  :|.:|.|||||:.:.::......:|||.:|::|        |.::
plant   130 AACAVEMIHTSSLIHDDLPCMDDADLRRGKPTNHKVFGEHMAVLAGDALLALAFEHMTVVSSGLV 194

  Fly   241 A---RLRSDDVTIVLSQILT-DLVQGEFMQLGSR-------ETENERFAHYLTKTYRKTASLIAN 294
            |   .:||  ||.:...|.| .||.|:...|.|:       ..|...|.|     ..|||:|:..
plant   195 APERMIRS--VTELAKAIGTKGLVAGQVSDLCSQGLNPYDVGLERLEFIH-----LHKTAALLEA 252

  Fly   295 ALKATAVIAQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLF 359
            |....|:|....:...:...:|||.|||.||:|||::|...|||::||....|:.....|.|.|.
plant   253 AAVLGAIIGGGTEEEIQKLRKYGRCIGLLFQVVDDIIDVTESTEELGKTAGKDVMARKLTYPRLI 317

  Fly   360 ACEKYPELNPMVMRRFSE 377
            ..|:..|:...:.|..:|
plant   318 GLERSREVAEKLRREAAE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 82/295 (28%)
AT3G32040NP_189747.1 Trans_IPPS_HT 93..358 CDD:173833 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54105
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100316
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.