DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and AT3G20160

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_188651.1 Gene:AT3G20160 / 821560 AraportID:AT3G20160 Length:344 Species:Arabidopsis thaliana


Alignment Length:338 Identity:84/338 - (24%)
Similarity:133/338 - (39%) Gaps:85/338 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SLQYSQSSKANLRQHSSVHTQQPAGPVREFQIDPYIILDDDLKYFYDDVRYLLKSGTSQPELDTI 144
            |...:::...|.....:|..::|...:||                  .:||.|.|          
plant    52 SYMVNKAKSVNKALEEAVPLREPELKIRE------------------AMRYTLLS---------- 88

  Fly   145 ASYYFDGQGKALRPMVTMLMAKAINYHLNNESHQLVHKQRQIALFS----EMVHSASLVHDDV-- 203
                   .||.:|||:.:...            :||..|...|:.:    ||:|::||:.||:  
plant    89 -------DGKRVRPMLCLAAC------------ELVGGQESTAMSAACAIEMLHASSLILDDLPC 134

  Fly   204 IDQSDFRRGKPSVNALWNHKKVTMAGDYILSIASIMIARLRSDDVTIVLSQILTDLVQ------- 261
            :|....|||||:.:.::......:|...::::|   :.:..|.....|..:.:...||       
plant   135 MDNDSLRRGKPTNHIVFGESIAILASQALIALA---VQKTTSSTFADVPPERILKTVQEMVKAVE 196

  Fly   262 -----------GEFMQLGSRET--ENERFAHYLTKTYRKTASLIANALKATAVIAQADDNVAEVA 313
                       ||.|:..| :|  |:..|.|     ..|||:|:..|....|::....|...|..
plant   197 GLVAGQQADLAGEGMRFDS-DTGLEHLEFIH-----IHKTAALLEAAAVMGAIMGGGSDEEIERL 255

  Fly   314 FQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLFACEK---YPELNPMVMRRF 375
            ..|.|.|||.||:|||:||...|:|::||....||..|..|.|.|...||   |.|...:..|..
plant   256 RSYARCIGLMFQVVDDVLDVTKSSEELGKTAGKDLIAGKLTYPRLMGVEKSKEYAERLNIEAREH 320

  Fly   376 SEPGDVERAFELV 388
            ....|:::...||
plant   321 LLGFDIDKVAPLV 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 78/301 (26%)
AT3G20160NP_188651.1 Trans_IPPS_HT 78..342 CDD:173833 80/312 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54105
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100316
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.