DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and AT2G18620

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_179452.1 Gene:AT2G18620 / 816377 AraportID:AT2G18620 Length:347 Species:Arabidopsis thaliana


Alignment Length:371 Identity:89/371 - (23%)
Similarity:147/371 - (39%) Gaps:87/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NLRQHSSVHTQQPAGPVREFQIDPYII------------LDDDLKY-FYDDVRYLL-KSGTSQPE 140
            ||....||.....|......:|.|:::            .|:.:.: .:|...|:: |:......
plant     5 NLSIFPSVKISSSASIPGFIKIQPFLLRRKLSTVLSVTARDEGIIHNHFDFTSYMIGKANAVNEA 69

  Fly   141 LDTIAS------------YYFDGQGKALRPMVTMLMAKAINYHLNNESHQLVHKQRQIALFS--- 190
            ||:..|            |....:||.:||::.:...            :||..:..:||.:   
plant    70 LDSAVSLREPIKIHEAIRYSLLARGKRVRPVLCIAAC------------ELVGGEESVALPAACA 122

  Fly   191 -EMVHSASLVHDDV--IDQSDFRRGKPSVNALWNHKKVTMAGDYILSIASIMIARLRSDDVTIVL 252
             ||:|:.||:|||:  :|..|.|||||:.:.::......:|||.::|.|...:|...:.....|:
plant   123 VEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALISFAFEHLATSTAVSPARVV 187

  Fly   253 SQI--------LTDLVQGEFMQLGSRETENE-------RFAHYLTKTYRKTASLIANALKATAVI 302
            ..|        ...||.|:.:.|.|...:..       .|.|     ..|||.|:..|....|::
plant   188 RAIGELAKAIGSKGLVAGQVVDLTSGGMDQNDVGLEVLEFIH-----VHKTAVLLEAATVLGAIV 247

  Fly   303 AQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLFACEKYPEL 367
            ....|...|...::.|.|||.||:|||:||...|:|::||....||.....|.|.|...||..:.
plant   248 GGGSDEEVEKLRRFARCIGLLFQVVDDILDVTKSSEELGKTAGKDLIADKLTYPKLMGLEKSKDF 312

  Fly   368 NPMVMRRFSEPGDVERAFELVHKS-HGLEQTR---------FLAKK 403
                         .::.....|:. ||.:.:|         ::||:
plant   313 -------------ADKLLSDAHEQLHGFDSSRVKPLLALANYIAKR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 82/332 (25%)
AT2G18620NP_179452.1 Trans_IPPS_HT 82..345 CDD:173833 74/292 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54105
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100316
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.