DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and Pdss2

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_082048.2 Gene:Pdss2 / 71365 MGIID:1918615 Length:401 Species:Mus musculus


Alignment Length:341 Identity:84/341 - (24%)
Similarity:155/341 - (45%) Gaps:53/341 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ILDDDLKYFYDDVRYLLKSGTSQPELDTIASYYFDGQ-GKALRPMVTMLMAKAINYHLNN---ES 176
            :|.|:|......||.|:  ||..|.|.|..:...|.: ...||.:|.:|::||......|   ::
Mouse    73 LLSDELSNIAMQVRKLV--GTGHPLLTTARALVHDSRHNLQLRGLVVLLISKAAGPSTRNAACQN 135

  Fly   177 HQLVHK----QRQIALFSEMVHSASLVHDDVIDQSDFRRGK-PSVNALWNHKKVTMAGDYILSIA 236
            :.:|..    ||.:|..:|::|:|.|||..:::.|:.:... |..:..:.:|...::||::|:.|
Mouse   136 YDMVSGVYSCQRSLAEITELIHTALLVHRGIVNLSELQSSDGPLKDMQFGNKIAILSGDFLLANA 200

  Fly   237 SIMIARLRSDDVTIVLSQILTDLVQGEFMQLGSRETENE-----RFAHYLTKTYRKTASLIANAL 296
            ...:|.|::..|..:||..|.|||.|.:.:..:...||.     ..:.:..:|:....:|:|.:.
Mouse   201 CNGLALLQNTKVVELLSSALMDLVHGVYQENSASTKENSIPDDIGISTWKEQTFLSHCALLAKSC 265

  Fly   297 KATAVIAQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLK-LGLATAPVLF- 359
            :|...:|:.|..|.::|||||:::.::.::..|:..|:       |..|:|.| ..|.:|||:. 
Mouse   266 QAAMELAKHDAAVQDMAFQYGKHMAMSHKINADLQPFI-------KDKASDSKTFNLNSAPVVLH 323

  Fly   360 ---------------ACEKYPELNPMVMRRFSEPGDVERAFELVHKSHGLEQTRFLAKKHCNEAI 409
                           |.|| ..||...:|            |.:....|:.....|.:.|.|:|:
Mouse   324 QEFLGRDLWIKQIGEAQEK-GSLNYSKLR------------ETIKAGKGVTSAIDLCRYHGNKAL 375

  Fly   410 RLAQELTESPYQKGLQ 425
            ...:....|..:..|:
Mouse   376 EALESFPPSEARSALE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 84/340 (25%)
Pdss2NP_082048.2 Isoprenoid_Biosyn_C1 69..401 CDD:294142 84/341 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.