DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and PDSS2

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_011534258.1 Gene:PDSS2 / 57107 HGNCID:23041 Length:465 Species:Homo sapiens


Alignment Length:256 Identity:68/256 - (26%)
Similarity:129/256 - (50%) Gaps:21/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ILDDDLKYFYDDVRYLLKSGTSQPELDTIASYYFDG-QGKALRPMVTMLMAKAINYHLNNESHQ- 178
            :|.|:|......||.|:  ||..|.|.|......|. ....||.:|.:|::||......|.|.| 
Human    72 LLSDELSNIAMQVRKLV--GTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQN 134

  Fly   179 ------LVHKQRQIALFSEMVHSASLVHDDVIDQSDFRRGK-PSVNALWNHKKVTMAGDYILSIA 236
                  :...||.:|..:|::|.|.|||..:::.::.:... |..:..:.:|...::||::|:.|
Human   135 YDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANA 199

  Fly   237 SIMIARLRSDDVTIVLSQILTDLVQGEFMQLG-SRE---TENERFAHYLTKTYRKTASLIANALK 297
            ...:|.|::..|..:|:..|.|||||.:.:.. |:|   |::...:.:..:|:....:|:|.:.:
Human   200 CNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQ 264

  Fly   298 ATAVIAQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVL 358
            |...:|:.|..|..:|||||:::.::.::..|:..|:.      :.|:..:...|.:|||:
Human   265 AAMELAKHDAEVQNMAFQYGKHMAMSHKINSDVQPFIK------EKTSDSMTFNLNSAPVV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 68/255 (27%)
PDSS2XP_011534258.1 Isoprenoid_Biosyn_C1 68..465 CDD:294142 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.