DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and pdss2

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001002351.1 Gene:pdss2 / 436624 ZFINID:ZDB-GENE-040718-43 Length:370 Species:Danio rerio


Alignment Length:326 Identity:80/326 - (24%)
Similarity:154/326 - (47%) Gaps:23/326 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ILDDDLKYFYDDVRYLLKSGTSQPELDTIASYYFDGQGK-ALRPMVTMLMAKAINYHLNNESHQ- 178
            :|.|:|......||.|:  ||..|.|:|...:.:|.:.. .:|.:|.:||:||.....::..|. 
Zfish    49 LLSDELSNVAMHVRKLV--GTKHPLLNTARGFVYDSRNNLQMRGLVVLLMSKAAGPSSSDPIHDS 111

  Fly   179 ----LVHKQRQIALFSEMVHSASLVHDDVIDQSDFRRGK-PSVNALWNHKKVTMAGDYILSIASI 238
                :...||.:|..:|::|:|.|||..:::..::.... |..:..:.:|...::||::|:.|..
Zfish   112 MVSGIYPSQRNLAEITELIHTAFLVHRGIVNLKEWTNSDGPLKDMQFGNKMAVLSGDFLLANACT 176

  Fly   239 MIARLRSDDVTIVLSQILTDLVQGEFMQ-LGSRETENERFAHYLTKTYRKTASLIANALKATAVI 302
            .:|:|....|..::|..:.|:|||.:.: .||.|.::...|.:..:.:....:|:|.:.:|...:
Zfish   177 GLAQLNDTKVVELISSAIGDVVQGIYHESSGSAEEDSLTVASWEDQAFLSHGALLAKSCQAAMKL 241

  Fly   303 AQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLF-----ACE 362
            |:.:.....:|||||:::.|..:|..::..||.|    |...|.   ..|.:|||:|     ..|
Zfish   242 ARHNTEAQNLAFQYGKHLALGHKLNSELQPFVKS----GSEGAV---FHLDSAPVVFHRQIVGPE 299

  Fly   363 KYPELNPMVMRRFSEPGDVERAFELVHKSHGLEQTRFLAKKHCNEAIRLAQELTESPYQKGLQVV 427
            ::.:..... :..|...|..:...|:....|:.|...|...|.|:|:...:....|..:..|:.:
Zfish   300 RWQQQLKQA-QNMSRQIDYTKLRGLIKMERGVSQALDLCSYHGNKALEAMKCFPPSDARSALENM 363

  Fly   428 A 428
            |
Zfish   364 A 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 80/325 (25%)
pdss2NP_001002351.1 Isoprenoid_Biosyn_C1 45..364 CDD:294142 79/324 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.