DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and qm

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster


Alignment Length:315 Identity:76/315 - (24%)
Similarity:139/315 - (44%) Gaps:35/315 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 KSGTSQPELDTIA----SYYFDGQGKALRPMVTMLMAKAINYHLNNESHQLVHKQRQIALFSEMV 193
            |..::|.|.|.|.    :|.....||..|..    :|.|.|:.|.....:|.    ||....:|:
  Fly    12 KDKSTQKEQDEILLQPFTYIQQIPGKQFRSE----LALAFNHWLLIPGEKLA----QIGDIVQML 68

  Fly   194 HSASLVHDDVIDQSDFRRGKPSVNALWNHKKVTMAGDYILSIASIMIARLRSDDVTIVLSQILTD 258
            |::||:.||:.|.|..|||.|..::::.......|.:|.|.:|...:.:|...:.|.|.::.|.:
  Fly    69 HNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLE 133

  Fly   259 LVQGEFMQLGSRE-----TENERFAHYLTKTYRKTASLIANALKATAVIAQADDNVAEVAFQYGR 318
            |.:|:.|::..|:     :|::    |...|.|||..|...|::...:.:...::.:::.    .
  Fly   134 LHRGQGMEIYWRDSFTCPSESD----YKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLT----A 190

  Fly   319 NIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLFA--CEKYPELNPMVMRRFSEPGDV 381
            .:||.||:.||..:.........|..|.||..|....||:.|  .:|..:....::|:.:...:|
  Fly   191 ILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILRQRTHDIEV 255

  Fly   382 ER-AFELVHKSHGLEQTRFLAKKHCNEAIRLAQELTESPYQKGLQVVADLVINRM 435
            :: ...|:.|....:.||.:.:....||......|..:||.       |.::|::
  Fly   256 KKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYM-------DRLLNKL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 76/313 (24%)
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 62/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12001
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.