DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and Fpps

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster


Alignment Length:387 Identity:92/387 - (23%)
Similarity:152/387 - (39%) Gaps:67/387 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 QSLQYSQSSKANLRQHS---SVHTQQPAGPVREFQ-IDPYIILD-----------DDLKYFYDDV 128
            |.|:.:..:.:.|:.||   :..........|:|. :.|.::.|           |..|:|...:
  Fly    54 QKLKKTSRTLSTLQNHSVPIAARVTVSKDESRDFMAVFPDLVRDITTVTKAYNCSDAAKWFAQVL 118

  Fly   129 RYLLKSGTSQPELDTIASYYFDGQGKALRPMVTMLMAKAINYHLNNESHQLVHKQRQIALFSEMV 193
            :|.:..|.....:.|:.:|      |.|.|          ...|..|:.:|.   :.:....||:
  Fly   119 QYNVPRGKKNRGILTVLTY------KNLVP----------TQDLTPENIKLA---QYLGWCVEML 164

  Fly   194 HSASLVHDDVIDQSDFRRGKPSVNALWNHK----KVTMAGDYILSIASIMIARLRSD----DVTI 250
            .|..::.|||:|.|..|||:|    .| ||    .:|...| .|.|.:.|.|.|:..    |..:
  Fly   165 QSFFIISDDVMDNSTTRRGQP----CW-HKVENVGLTAIND-ALMIENAMYAILKKHFSHLDCYV 223

  Fly   251 VLSQILTDLVQ----GEFM-QLGSRETENE-RFAHYLTKTYRKTASLIANALKATAVIAQADDNV 309
            .|.::..::..    |:.: ||.|....:| ...:|......||| ..:..|.....:..|....
  Fly   224 ALMELFHEITYITTCGQSLDQLNSNRCVSEFTMENYKAIVENKTA-YYSFYLPFALALHLAGYKD 287

  Fly   310 AEVAFQYGRNI----GLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLFACEKYPELNPM 370
            || ||:..:.|    |..||:.||.||...:.|..|| ...|::....:...:.|.::.......
  Fly   288 AE-AFRQSKTILLEMGNFFQVQDDFLDCFGNPEVTGK-IGTDIQDNKCSWLAVVAMQRANVEQKQ 350

  Fly   371 VM---RRFSEPGDVERAFELVHKSHGLEQTRFLAKKHCNEAIR--LAQELTESPYQKGLQVV 427
            :|   ....||..|||..|| :|..||..|..:.::.....|:  :.|.....|:|..||::
  Fly   351 IMVDCYGKEEPAKVERVKEL-YKELGLPSTYAIFEEESYNMIKTHIQQTSRGVPHQTFLQIL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 84/345 (24%)
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 72/286 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.