DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and Ggps1

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001007627.1 Gene:Ggps1 / 291211 RGDID:1359680 Length:300 Species:Rattus norvegicus


Alignment Length:266 Identity:62/266 - (23%)
Similarity:117/266 - (43%) Gaps:26/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 YYFDGQGKALRPMVTMLMAKAINYHLNNESHQLVHKQRQIAL-FSEMVHSASLVHDDVIDQSDFR 210
            |.....||.:|..    :::|.|:.|.....:|     ||.: .:||:|:|||:.||:.|.|..|
  Rat    18 YLLQLPGKQVRTK----LSQAFNHWLKVPEDKL-----QIIIEVTEMLHNASLLIDDIEDSSKLR 73

  Fly   211 RGKPSVNALWNHKKVTMAGDYILSIASIMIARLRSDDVTIVLSQILTDLVQGEFMQLGSRE---- 271
            ||.|..::::....|..:.:|:..:....:..|...|...:.::.|.:|.||:.:.:..|:    
  Rat    74 RGFPVAHSIYGVPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDTYTC 138

  Fly   272 -TENERFAHYLTKTYRKTASLIANALKATAVIAQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVS 335
             ||.|    |.....:||..|...|:....:.:...:::..:.    ..:||.||:.||..:..|
  Rat   139 PTEEE----YKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLL----DTLGLFFQIRDDYANLHS 195

  Fly   336 STEQMGKPTAADLKLGLATAPVLFACEKYPELNPM--VMRRFSEPGDVER-AFELVHKSHGLEQT 397
            ......|....||..|..:.|.:.|....||...:  ::|:.:|..|::: ..:.:......|.|
  Rat   196 KEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVQYLEDVGSFEYT 260

  Fly   398 RFLAKK 403
            |:..::
  Rat   261 RYTLRE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 62/266 (23%)
Ggps1NP_001007627.1 polyprenyl_synt 9..251 CDD:395277 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.