DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and Ggps1

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001318048.1 Gene:Ggps1 / 14593 MGIID:1341724 Length:300 Species:Mus musculus


Alignment Length:281 Identity:64/281 - (22%)
Similarity:117/281 - (41%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 IDPYIILDDDLKYFYDDVRYLLKSGTSQPELDTIASYYFDGQGKALRPMVTMLMAKAINYHLNNE 175
            ::||              ||||:.                 .||.:|..    :::|.|:.|...
Mouse    13 LEPY--------------RYLLQL-----------------PGKQVRSK----LSQAFNHWLKVP 42

  Fly   176 SHQLVHKQRQIAL-FSEMVHSASLVHDDVIDQSDFRRGKPSVNALWNHKKVTMAGDYILSIASIM 239
            ..:|     ||.: .:||:|:|||:.||:.|.|..|||.|..::::....|..:.:|:..:....
Mouse    43 EDKL-----QIIIEVTEMLHNASLLIDDIEDSSKLRRGFPVAHSIYGVPSVINSANYVYFLGLEK 102

  Fly   240 IARLRSDDVTIVLSQILTDLVQGEFMQLGSRE-----TENERFAHYLTKTYRKTASLIANALKAT 299
            :..|...|...:.::.|.:|.||:.:.:..|:     ||.|    |.....:||..|...|:...
Mouse   103 VLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDTYTCPTEEE----YKAMVLQKTGGLFGLAVGLM 163

  Fly   300 AVIAQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLFACEKY 364
            .:.:...:::..:.    ..:||.||:.||..:..|......|....||..|..:.|.:.|....
Mouse   164 QLFSDYKEDLKPLL----DTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSR 224

  Fly   365 PELNPM--VMRRFSEPGDVER 383
            ||...:  ::|:.:|..|:::
Mouse   225 PESTQVQNILRQRTENIDIKK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 62/275 (23%)
Ggps1NP_001318048.1 polyprenyl_synt 9..251 CDD:395277 64/281 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.