DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qless and Fdps

DIOPT Version :9

Sequence 1:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001240680.1 Gene:Fdps / 110196 MGIID:104888 Length:420 Species:Mus musculus


Alignment Length:361 Identity:72/361 - (19%)
Similarity:122/361 - (33%) Gaps:99/361 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YSQSSKANLRQHSSVHTQQPAGPVREFQIDPYIILDDDLKYFYDDVRYLLKSGTSQPELDTIASY 147
            :|.|.:.|..|....:.|:.               .:.:::|...|:.|.:.....||:      
Mouse    62 FSSSVRMNGNQKLDAYNQEK---------------QNFIQHFSQIVKVLTEKELGHPEI------ 105

  Fly   148 YFDGQGKALRPMVTMLMAKAINYHLN------NESHQLVHKQRQ----------IALFSEMVHSA 196
                 |.|:..:..:|...|:....|      ....:||..::|          :....|::.:.
Mouse   106 -----GDAIARLKEVLEYNALGGKYNRGLTVVQAFQELVEPKKQDAESLQRALTVGWCVELLQAF 165

  Fly   197 SLVHDDVIDQSDFRRG------KPSVNALWNHKKVTMAGDYILSIASIMIARL-----RSDDVTI 250
            .||.||::|.|..|||      ||.:.       :....|.:|..|||.  ||     |.....:
Mouse   166 FLVSDDIMDSSLTRRGQICWYQKPGIG-------LDAINDALLLEASIY--RLLKFYCREQPYYL 221

  Fly   251 VLSQIL------TDLVQGEFMQLGSRETENERFAHYLTKTYR-----KTASL-----IANALKAT 299
            .|.::.      |::  |:.:.|.:....:.....|..|.|:     |||..     ||.|:...
Mouse   222 NLLELFLQSSYQTEI--GQTLDLMTAPQGHVDLGRYTEKRYKSIVKYKTAFYSFYLPIAAAMYMA 284

  Fly   300 AVIAQADD-NVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGK--PTAADLKLGLATAPVLFAC 361
            .:..:.:. |..::..:.|.    .||:.||.||........||  ....|.|........|...
Mouse   285 GIDGEKEHANALKILMEMGE----FFQVQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRA 345

  Fly   362 ---------EKYPELNPMVMRRFS---EPGDVERAF 385
                     |.|.:.:|..:.|..   |..|::.||
Mouse   346 SPQQRQILEENYGQKDPEKVARVKALYEALDLQSAF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 67/327 (20%)
FdpsNP_001240680.1 MSP1_C 72..>144 CDD:284802 14/97 (14%)
polyprenyl_synt 117..378 CDD:278763 57/275 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.