DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15564 and CG15563

DIOPT Version :10

Sequence 1:NP_651855.1 Gene:CG15564 / 43696 FlyBaseID:FBgn0039833 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_651854.2 Gene:CG15563 / 43695 FlyBaseID:FBgn0039832 Length:116 Species:Drosophila melanogaster


Alignment Length:33 Identity:13/33 - (39%)
Similarity:17/33 - (51%) Gaps:5/33 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KQEYYDLFHQHCP-----WGRPGGGAPNVEVRR 86
            ||...||.:||..     |||||.||...::.:
  Fly    70 KQLDRDLCNQHFDTFETFWGRPGHGARGDKINK 102

Return to query results.
Submit another query.