DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12054 and SFP1

DIOPT Version :9

Sequence 1:NP_651853.1 Gene:CG12054 / 43694 FlyBaseID:FBgn0039831 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_013507.1 Gene:SFP1 / 851119 SGDID:S000004395 Length:683 Species:Saccharomyces cerevisiae


Alignment Length:505 Identity:90/505 - (17%)
Similarity:127/505 - (25%) Gaps:303/505 - (60%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CK-YNGCGITFPSLSDLISHIEDTHIDYDPKVVEQKEQAQPACLPL------------------- 53
            || |:.||::.|.|.||:.|.|:.||...|......:      :|:                   
Yeast   200 CKDYSCCGLSLPGLHDLLRHYEEAHISTSPNTTNMSQ------IPMNSAGNTSSSVRMTNNTSSA 258

  Fly    54 SYVLRFITEENRKEA-------------------------------------------------- 68
            :|.|:.....|.|.|                                                  
Yeast   259 NYNLQNNMAANTKNAGHKTNTMQAHSSNATNNTSINNMHANLQSNMDSNSTIRQSQHPHHQQNII 323

  Fly    69 ----------------------GSFLASNTTAPPTT-------NSGSNAAGHG------------ 92
                                  ||..||:|||.|..       |||.:.|.|.            
Yeast   324 QQQLQSNSVNHTSGAVPTPSVMGSATASSTTANPNVISITGAPNSGLSMANHSQQLHLNGNLVDA 388

  Fly    93 ----------------------------------------NGNVELKRKLAIKH-----HSYSMS 112
                                                    |.|:.:..|.|:.:     ::||::
Yeast   389 VSTNDVFLRTSNSPSRHVPHNKQINSNNNSGININNNTSHNSNINMGSKNAMVNRPHTFNNYSLN 453

  Fly   113 SSNRS-----------------------------------------------TTPTGS------- 123
            .::|:                                               ...|||       
Yeast   454 KTSRNPIQHQSRKIDPHQTDLSPLVLVQDIDLSFMDDDILGPSNHNSMNSVVNPTTGSHNYNTFH 518

  Fly   124 ------------------EMDEDEMVVTESEDSNDSWTTEEFSSEFIMRYGSRHSGGGSNG---- 166
                              ::|:|:.|..:.:|.:|..|               .:|..|||    
Yeast   519 SSVHAKSSQNMVEDQDIDDIDDDDDVDDDDDDDDDDDT---------------ENGSSSNGKSVH 568

  Fly   167 -------------TPG---------NEKPFACPVPGCKKRYKNVNGIKYHSKNGHKK-------D 202
                         .|.         .:|||.|||.||:|.|||.||:|||..:||:.       |
Yeast   569 NNNYKMPQQAYIDDPARRLYVMDHEEQKPFKCPVIGCEKTYKNQNGLKYHRLHGHQNQKLHENPD 633

  Fly   203 GRVR-------------------KGYKCH-CGKSYKTAQGLKNHALH-TH 231
            |...                   |.|:|. |||.||...|||.|..| ||
Yeast   634 GTFSVIDPDSTDSFGDGMGSAKDKPYRCEVCGKRYKNLNGLKYHRGHSTH 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12054NP_651853.1 SFP1 <123..231 CDD:227516 46/186 (25%)
SFP1NP_013507.1 SFP1 43..683 CDD:227516 88/503 (17%)
C2H2 Zn finger 600..629 CDD:275368 16/28 (57%)
C2H2 Zn finger 661..683 CDD:275368 11/21 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5189
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005653
OrthoInspector 1 1.000 - - oto99878
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23057
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1327
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.