DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12054 and jazf1b

DIOPT Version :9

Sequence 1:NP_651853.1 Gene:CG12054 / 43694 FlyBaseID:FBgn0039831 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_021322355.1 Gene:jazf1b / 494088 ZFINID:ZDB-GENE-041212-56 Length:243 Species:Danio rerio


Alignment Length:247 Identity:119/247 - (48%)
Similarity:154/247 - (62%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVFLINVCKYNGCGITFPSLSDLISHIEDTHIDYDPKVVEQKEQAQPACLPLSYVLRFITEENRK 66
            |.|..|:|::.|||:.|.||::||.||||.|||.||:|:|::|..||..:.|||:.||:|:..|:
Zfish     7 ASFFSNICQFGGCGLHFESLAELIVHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARR 71

  Fly    67 E----------------AGSFLASNTTAPPTTNSGSNAAGHGNGNVELKRKLAIKHHSYSMSSSN 115
            |                .||...|:...||.         |.:||:.......|     :.|||.
Zfish    72 EHESLKKKVQPKLSLSLMGSLSRSSVATPPR---------HNSGNLTPPVTPPI-----TPSSSF 122

  Fly   116 RSTTPTGSEMDEDEMVVTESEDSNDSWTTEE-FSSEFIMRYGSRHSGGGSNGTPGNEKPFACPVP 179
            ||:||||||.||:|....|| ||::|||||. .|||:|:      |....||  |:|||||||||
Zfish   123 RSSTPTGSEYDEEEAEYEES-DSDESWTTESAISSEYIL------SSMCMNG--GDEKPFACPVP 178

  Fly   180 GCKKRYKNVNGIKYHSKNGHKKDGRVRKGYKCHCGKSYKTAQGLKNHALHTH 231
            |||||||||||||||:||||:...||||.:||.||||||::|||::|.::.|
Zfish   179 GCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKSSQGLRHHTINFH 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12054NP_651853.1 SFP1 <123..231 CDD:227516 66/108 (61%)
jazf1bXP_021322355.1 SFP1 <169..230 CDD:227516 44/60 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5189
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005653
OrthoInspector 1 1.000 - - otm25550
orthoMCL 1 0.900 - - OOG6_108585
Panther 1 1.100 - - LDO PTHR23057
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1327
SonicParanoid 1 1.000 - - X5309
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.